ࡱ>  PbjbjT~T~ kR66^M$PU$y4Ez]"ZZZEEEEEEE$8GI8?E9 ZZ ?ExE111 <c>1 E11:6,k70qc9(7 O>E0E7RKU+dKk7k7DK7Z15ZZZ?E?E.(ZZZE KZZZZZZZZZ : Running head: Social support and regular physical activity. Social support and regular physical activity: Does planning mediate this link? *Molloy GJ, Dixon D, Department of Psychology, Cottrell Building, ż, FK9 4LA, Scotland. Hamer M Department of Epidemiology & Public Health University College London, WC1E 6BT, England. Sniehotta FF School of Psychology, University of Aberdeen, AB24 2UB, Scotland. Word count (exc. Figures/tables): 3,878 *Corresponding author: Department of Psychology, Cottrell Building, ż, FK9 4LA, Scotland. E-mail: g.j.molloy@stir.ac.uk Phone: + 44 (0) 1786 46 7655 Objectives: Social support for physical activity is reliably associated with regular physical activity, however the social cognitive processes, particularly post-intentional processes, that can explain this link have not been well characterised. In this study we examined the extent to which the relationship between social support for physical activity and subsequent physical activity can be accounted for by planning processes. Design & Method: The design was prospective observational and the sample consisted of 903 university students. Participants completed standard TPB, planning and physical activity measures at 2 time points, approximately 7 weeks apart. A gender stratified multiple mediation model was conducted to test the study hypotheses. Results: A significant interaction between social support and gender was observed. This indicated that lower levels of social support for physical activity were associated with lower levels of physical activity at time 2, for women only. In multiple mediation analysis this was partly explained by the indirect effects of social support through perceived behavioural control and coping planning. Conclusion: These findings highlight the importance of interpersonal processes in understanding the post-intentional determinants of regular physical activity. It is likely that planning processes relating to physical activity are often influenced by those in the ongoing immediate social environment who support this behaviour. Future development of theory and interventions should take account of the socially interactive nature of planning processes. Introduction Social support for regular physical activity has been one of the most studied psychosocial determinants of regular physical activity  ADDIN REFMGR.CITE Trost200220Correlates of adults' participation in physical activity: review and updateJournal20Correlates of adults' participation in physical activity: review and updateTrost,S.G.Owen,N.Bauman,A.E.Sallis,J.F.Brown,W.2002/12ACTIVITY PATTERNSCOMMUNITYdemographicdeterminantsenvironmentalExerciseEXERCISE BEHAVIORLEISURE-TIMEliterature reviewOLDER ADULTSPLANNED BEHAVIORPOPULATIONpsychologicalSELF-EFFICACYsocialWOMENNot in File19962001Medicine and Science in Sports and Exercise34120195-9131
Univ Queensland, Sch Human Movement Studies, Brisbane, Qld 4072, Australia Univ Queensland, Sch Populat Hlth, Brisbane, Qld 4072, Australia San Diego State Univ, Dept Psychol, San Diego, CA 92182 USA Univ New S Wales, Sch Community Med, Kensington, NSW 2033, Australia
ISI:000179757300020Medicine and Science in Sports and Exercise1
Courneya20009Social support and the theory of planned behavior in the exercise domainJournal9Social support and the theory of planned behavior in the exercise domainCourneya,K.S.Plotnikoff,R.C.Hotz,S.B.Birkett,N.J.2000/7ADHERENCEADULTSattitudesBEHAVIORCOMMUNITYdemographicDOMAINExerciseEXERCISE INTENTIONIDENTIFYintentionINTENTIONSMODELPHYSICAL-ACTIVITYPLANNED BEHAVIORPREDICTIONREGULAR EXERCISEsocialSOCIAL SUPPORTSUPPORTtheory of planned behaviorNot in File300308American Journal of Health Behavior2441087-3244
Univ Alberta, Fac Phys Educ, Van Vliet Ctr E401, Edmonton, AB T6G 2H9, Canada Univ Alberta, Alberta Ctr Well Being, Ctr Hlth Promot Studies, Edmonton, AB T6G 2H9, Canada Univ Ottawa, Fac Med, Dept Epidemiol & Community Med, Ottawa, ON K1N 6N5, Canada Univ Ottawa, Sch Psychol, Ottawa, ON K1N 6N5, Canada
ISI:000087954700006American Journal of Health Behavior1
Sallis199266Explanation of Vigorous Physical-Activity During 2 Years Using Social-Learning VariablesJournal66Explanation of Vigorous Physical-Activity During 2 Years Using Social-Learning VariablesSallis,J.F.Hovell,M.F.Hofstetter,C.R.Barrington,E.1992/1ADULTSBARRIERSBEHAVIORCOMMUNITYCOMMUNITY SAMPLEdemographicdeterminantsExerciseFAMILYhealth promotionphysical activityPHYSICAL-ACTIVITYREGRESSIONSAMPLESELF-EFFICACYsocialSOCIAL LEARNING THEORYSUPPORTtheoryTIMEVARIABLESNot in File2532Social Science & Medicine3410277-9536ISI:A1992GY69500004Social Science & Medicine1
(Trost et al., 2002; Courneya et al., 2000; Sallis et al., 1992b). Duncan et al., (2005) provides a general definition of social support that subsumes a number of different theoretical approaches. They propose that social support refers to any behavior that assists an individual in achieving desired goals or outcomes. Several studies have clearly shown that social support for physical activity is reliably associated with greater levels of physical activity  ADDIN REFMGR.CITE Trost200220Correlates of adults' participation in physical activity: review and updateJournal20Correlates of adults' participation in physical activity: review and updateTrost,S.G.Owen,N.Bauman,A.E.Sallis,J.F.Brown,W.2002/12ACTIVITY PATTERNSCOMMUNITYdemographicdeterminantsenvironmentalExerciseEXERCISE BEHAVIORLEISURE-TIMEliterature reviewOLDER ADULTSPLANNED BEHAVIORPOPULATIONpsychologicalSELF-EFFICACYsocialWOMENNot in File19962001Medicine and Science in Sports and Exercise34120195-9131
Univ Queensland, Sch Human Movement Studies, Brisbane, Qld 4072, Australia Univ Queensland, Sch Populat Hlth, Brisbane, Qld 4072, Australia San Diego State Univ, Dept Psychol, San Diego, CA 92182 USA Univ New S Wales, Sch Community Med, Kensington, NSW 2033, Australia
ISI:000179757300020Medicine and Science in Sports and Exercise1
(Trost et al., 2002), particularly among women  ADDIN REFMGR.CITE Sallis199269Predictors of Adoption and Maintenance of Vigorous Physical-Activity in Men and WomenJournal69Predictors of Adoption and Maintenance of Vigorous Physical-Activity in Men and WomenSallis,J.F.Hovell,M.F.Hofstetter,C.R.1992/3AdoptiondeterminantsExerciseFITNESSMAINTENANCEMENphysical activityPHYSICAL-ACTIVITYPREDICTORSTIMEWOMENNot in File237251Preventive Medicine2120091-7435
SAN DIEGO STATE UNIV,GRAD SCH PUBL HLTH,SAN DIEGO,CA 92182 SAN DIEGO STATE UNIV,DEPT POLIT SCI,SAN DIEGO,CA 92182
ISI:A1992HK68400008Preventive Medicine1
Sallis199963Potential mediators of change in a physical activity promotion course for university students: Project GRADJournal63Potential mediators of change in a physical activity promotion course for university students: Project GRADSallis,J.F.Calfas,K.J.Alcaraz,J.E.Gehrman,C.Johnson,M.F.1999=SPRBARRIERSBEHAVIORBEHAVIOR-CHANGEbehavioral medicineBENEFITSENJOYMENTExerciseFRIENDSHEALTHHEALTH BEHAVIORINTENSITYINTERVENTIONINTERVENTIONSMALESMEDIATORMENMODELMODELSPERFORMANCEphysical activityPHYSICAL-ACTIVITYPROGRAMREGRESSIONSELF-EFFICACYsocialSOCIAL SUPPORTSTUDENTSSUPPORTtheoryVARIABLESWOMENNot in File149158Annals of Behavioral Medicine2120883-6612
San Diego State Univ, Dept Psychol, San Diego, CA 92120 USA
ISI:000086106000007Annals of Behavioral Medicine1
(Sallis et al., 1992a; Sallis et al., 1999). Previous work in the area of social cognition and physical activity has shown that this link can be partly explained by the relationship between social support for physical activity and beliefs about capability or control of engaging in regular physical activity e.g. self-efficacy  ADDIN REFMGR.CITE McAuley200313Exercise self-efficacy in older adults: Social, affective, and behavioral influences 13Journal13Exercise self-efficacy in older adults: Social, affective, and behavioral influences 13McAuley,E.Jerome,G.J.Marquez,D.X.Elavsky,S.Blissmer,B.2003=WINADHERENCEADULTSaffectBARRIERSCOGNITIONSCURVE ANALYSISELDERLY PATIENTSExerciseEXPECTATIONSMAINTENANCEMIDDLE-AGED MALESOLDEROLDER ADULTSOLDER-ADULTSPARTICIPATIONphysical activityPHYSICAL-ACTIVITYQUESTIONNAIRESELF-EFFICACYsocialSOCIAL SUPPORTSUPPORTWALKINGNot in File17Annals of Behavioral Medicine2510883-6612
Univ Illinois, Dept Kinesiol, Urbana, IL 61801 USA Univ Rhode Isl, Kingston, RI 02881 USA
ISI:000180872800001Annals of Behavioral Medicine1
(McAuley et al., 2003) from social cognitive theory  ADDIN REFMGR.CITE Bandura200472Health promotion by social cognitive meansJournal72Health promotion by social cognitive meansBandura,A.2004/4affectBEHAVIORcollective efficacyDISEASEEDUCATIONefficacyenvironmentalExerciseEXPECTATIONSGOALShabitHEALTHhealth promotionHEALTH-PROMOTIONmotivationOUTCOMESPEOPLEPHYSICAL-ACTIVITYpreventionPROGRAMRELAPSERISKSELF-EFFICACYself-management modelself-regulationSMOKING PREVENTIONsocialsocial cognitiveSOCIAL COGNITIVE THEORYtheoryTIMETRIALNot in File143164Health Education & Behavior3121090-1981
Stanford Univ, Dept Psychol, Stanford, CA 94305 USA
ISI:000220296900002Health Education & Behavior1
(Bandura, 2004) and perceived behavioral control  ADDIN REFMGR.CITE Courneya199510Cognitive Mediators of the Social-Influence Exercise Adherence Relationship - A Test of the Theory of Planned BehaviorJournal10Cognitive Mediators of the Social-Influence Exercise Adherence Relationship - A Test of the Theory of Planned BehaviorCourneya,K.S.McAuley,E.1995/10ADHERENCEattitudesBEHAVIORCOHESIONCONSTRUCTExerciseEXERCISE ADHERENCEGROUP COHESIONintentionINTENTIONSPHYSICAL-ACTIVITYPLANNED BEHAVIORPREDICTIONsocialSOCIAL SUPPORTSUBJECTIVE NORMSUPPORTtheory of planned behaviorNot in File499515Journal of Behavioral Medicine1850160-7715
UNIV ILLINOIS,URBANA,IL 61801
ISI:A1995RX84300006Journal of Behavioral Medicine1
(Courneya & McAuley, 1995) from the theory of planned behavior  ADDIN REFMGR.CITE Ajzen199171The Theory of Planned BehaviorJournal71The Theory of Planned BehaviorAjzen,I.1991/12ATTITUDE MODELSBEHAVIOREXPECTANCYFISHBEIN-AJZENINTENTIONSPERFORMANCEPLANNED BEHAVIORPREDICTIONREASONED ACTIONSELF-EFFICACYtheorytheory of planned behaviorTIMEtraitsVARIABLESNot in File179211Organizational Behavior and Human Decision Processes5020749-5978ISI:A1991GQ64400003Organizational Behavior and Human Decision Processes1(Ajzen, 1991). In these studies social support for physical activity is hypothesised to enhance control/efficacy beliefs relating to participating in regular physical activity. For example in social cognitive theory, social support could be viewed as a potential source of self-efficacy e.g. social supportive relationships may provide self-efficacy enhancing vicarious experience or verbal persuasion relating to regular physical activity  ADDIN REFMGR.CITE Bandura199784Self-efficacy: The exercise of controlBook, Whole84Self-efficacy: The exercise of controlBandura,A.1997/1/1SELF-EFFICACYExerciseNot in FileNew YorkWH Freeman2(Bandura, 1997). Recent work on the social cognitive determinants of regular physical activity has focused on post-intentional processes that facilitate the translation of intentions into action  ADDIN REFMGR.CITE Sniehotta200539Action planning and coping planning for long-term lifestyle change: Theory and assessment 9Journal39Action planning and coping planning for long-term lifestyle change: Theory and assessment 9Sniehotta,F.F.Schwarzer,R.Scholz,U.Schuz,B.2005/7ACTION PLANSBARRIERSBEHAVIORCOGNITIONSDISEASEExerciseGermanyHEALTHIMPLEMENTATION INTENTIONSintentionINTENTIONSINTERVENTIONINTERVENTIONSLIFEphysical exercisePHYSICAL-ACTIVITYplanningPLANSREHABILITATIONWOMENNot in File565576European Journal of Social Psychology3540046-2772
Univ Aberdeen, Coll Life Sci & Med, Sch Psychol, Kings Coll, Aberdeen AB24 2UB, Scotland Free Univ Berlin, D-1000 Berlin, Germany
ISI:000230837000008European Journal of Social Psychology1
(Sniehotta et al., 2005b). This research shows that processes relating to the post-intentional planning of behavior are important intermediate mechanisms operating between intention and behavior  ADDIN REFMGR.CITE Sniehotta200975Towards a theory of intentional behaviour change: Plans, planning, and self-regulationJournal75Towards a theory of intentional behaviour change: Plans, planning, and self-regulationSniehotta,F.F.2009/5COGNITIONSCONSTRUCTHEALTHIMPLEMENTATION INTENTIONSintentionINTENTIONSINTERVENTIONINTERVENTIONSMEDIATORMODERATORSplanningPLANSREASONED ACTIONself-regulationtheoryNot in File261273Br.J.Health Psychol.14Pt 2
University of Aberdeen, Aberdeen, UK
PM:19102817Br.J.Health Psychol.1
(Sniehotta, 2009). Action planning and coping planning in particular have emerged as two key constructs that operate between intention and behavior  ADDIN REFMGR.CITE Araujo-Soares200935Predicting changes in physical activity among adolescents: the role of self-efficacy, intention, action planning and coping planning 1Journal35Predicting changes in physical activity among adolescents: the role of self-efficacy, intention, action planning and coping planning 1Araujo-Soares,V.McIntyre,T.Sniehotta,F.F.2009/2ACTION PLANSadolescentsAGEBEHAVIORCHILDRENExerciseHEALTHIMPLEMENTATION INTENTIONSintentionINTERVENTIONMAINTENANCEphysical activityPHYSICAL-ACTIVITYpreventionPSYCHOLOGYQUESTIONNAIRESCALESELF-EFFICACYsocialNot in File128139Health Education Research2410268-1153
Robert Gordon Univ, Fac Hlth & Social Care, Aberdeen AB10 7QG, Scotland Univ Minho, Minho, Portugal Univ Aberdeen, Aberdeen AB9 1FX, Scotland
ISI:000262331300014Health Education Research1
(Araujo-Soares et al., 2009). Action planning is defined as a post-intentional process that links goal-directed responses to situational cues by specifying when, where, and how to act in accordance with ones goal intention. Coping planning is conceptualized as an independent planning cognition that prepares a person for successful coping with situations in which strong cues invite both unintended responses (e.g. habits) and intentional responses (e.g. newly planned actions)  ADDIN REFMGR.CITE Sniehotta2006325Action plans and coping plans for physical exercise: A longitudinal intervention study in cardiac rehabilitationJournal325Action plans and coping plans for physical exercise: A longitudinal intervention study in cardiac rehabilitationSniehotta,F.F.Scholz,U.Schwarzer,R.2006/2ACTION PLANSAdaptation,PsychologicalAdultAgedAged,80 and overassessmentBARRIERSCARDIAC REHABILITATIONcontrolled trialCoronary DiseaseDemographyExerciseFemaleFollow-Up StudiesHEALTH BEHAVIORHumansINTERVENTIONINTERVENTIONSLIFEMaleMiddle Agedphysical exercisephysical fitnessplanningPLANSPSYCHOLOGYrandomized controlled trialREHABILITATIONSchoolSelf EfficacyTime FactorsTRIALNot in File2337Br.J.Health Psychol.11Pt 1
University of Aberdeen, School of Psychology, College of Life Sciences and Medicine, King's College, Aberdeen, UK. f.sniehotta@abdn.ac.uk
PM:16480553Br.J.Health Psychol.1
(Sniehotta et al., 2006). These variables have been shown to predict physical activity and other health behaviors  ADDIN REFMGR.CITE Schwarzer200778Adoption and maintenance of four health behaviors: Theory-guided longitudinal studies on dental flossing, seat belt use, dietary behavior, and physical activityJournal78Adoption and maintenance of four health behaviors: Theory-guided longitudinal studies on dental flossing, seat belt use, dietary behavior, and physical activitySchwarzer,R.Schuz,B.Ziegelmann,J.P.Lippke,S.Luszczynska,A.Scholz,U.2007AdoptionBEHAVIORBEHAVIORSCARDIAC REHABILITATIONDIETARYExerciseFEARGermanyHEALTHHEALTH BEHAVIORIMPLEMENTATION INTENTIONSintentionINTENTIONSINTERNETMAINTENANCEMEDIATORMODELPATTERNSphysical activityPHYSICAL-ACTIVITYPLANNED BEHAVIORplanningPREDICTIONPREDICTORSQUESTIONNAIRERISKSAMPLEScheduling self-efficacySELF-EFFICACYsocialstructural equation modelingSTUDENTSTASKTIMEVARIABLESYOUNGNot in File156166Annals of Behavioral Medicine3320883-6612
Free Univ Berlin, D-14195 Berlin, Germany Univ Sussex, Brighton BN1 9RH, E Sussex, England Warsaw Sch Social Psychol, Warsaw, Poland Univ Zurich, CH-8006 Zurich, Switzerland
ISI:000247892500006Annals of Behavioral Medicine1
(Schwarzer et al., 2007) and interventions that can enhance planning have been shown to lead to increased physical activity, particularly in motivated patient groups  ADDIN REFMGR.CITE Sniehotta200538Long-term effects of two psychological interventions on physical exercise and self-regulation following coronary rehabilitation 8Journal38Long-term effects of two psychological interventions on physical exercise and self-regulation following coronary rehabilitation 8Sniehotta,F.F.Scholz,U.Schwarzer,R.Fuhrmann,B.Kiwus,U.Voller,H.2005ACTION PLANSADHERENCECARDIAC REHABILITATIONCARDIOVASCULAR-DISEASEExerciseEXERCISE ADHERENCEGermanyGUIDELINESHEART-DISEASEIMPLEMENTATION INTENTIONSINTENSITYintentionINTENTIONSINTERVENTIONINTERVENTIONSLIFEMAINTENANCEmotivationOF-CARDIOLOGYphysical activityphysical exercisePHYSICAL-ACTIVITYPLANNED BEHAVIORplanningpreventionPROGRAMSpsychologicalREHABILITATIONRISKRISK-FACTORSSTATEMENTSTRATEGIESNot in File244255International Journal of Behavioral Medicine1241070-5503
Univ Aberdeen, Sch Psychol, Coll Life Sci & Med, Kings Coll, Aberdeen AB24 2UB, Scotland Free Univ Berlin, D-1000 Berlin, Germany Rehabil Klin Seehof, Teltow, Germany Klin See, Rudersdorf, Germany
ISI:000233055200005International Journal of Behavioral Medicine1
(Sniehotta et al., 2005a). Planning processes aim to create new contingencies between (external) situational cues and behavioural responses (e.g. swimming) directly conducive to the pursuit of goal intentions (e.g. being physically active)  ADDIN REFMGR.CITE Sniehotta200975Towards a theory of intentional behaviour change: Plans, planning, and self-regulationJournal75Towards a theory of intentional behaviour change: Plans, planning, and self-regulationSniehotta,F.F.2009/5COGNITIONSCONSTRUCTHEALTHIMPLEMENTATION INTENTIONSintentionINTENTIONSINTERVENTIONINTERVENTIONSMEDIATORMODERATORSplanningPLANSREASONED ACTIONself-regulationtheoryNot in File261273Br.J.Health Psychol.14Pt 2
University of Aberdeen, Aberdeen, UK
PM:19102817Br.J.Health Psychol.1
(Sniehotta, 2009). It is likely that situational cues will often be social in their nature. For example a social action plan might take the form of I will go for a run when I meet X in the park on Tuesdays, where X is some ongoing social contact. A coping plan may also often be social in its nature in that it may be another person or a social interaction that prevents unwanted influences on behaviour e.g. I will go for run even if I am tired because X will be calling by to go running with me. However there are limited data on how such social supportive interactions relate to these planning processes, so these hypothesised links remain speculative. Understanding how planning relates to social support is therefore important for furthering our understanding of why social support for physical activity is a key determinant of regular physical activity in some groups. In this study we examine whether planning processes mediate the relationship between social support and regular physical activity. By way of comparison we also examine how the proximal predictors from the theory of planned behavior variables (intention and perceived behavioral control) mediate this association. Social support in the present study is conceptualised as received social support for engaging in physical activity. This type of social support refers to support received from other people i.e. an interpersonal process, and can be distinguished from perceived support, which refers to ones perception of potential access to social support and is more typically conceived of as an intrapersonal process (see Uchino, 2009 for a detailed discussion of this distinction). This focus on interpersonal as opposed to intrapersonal processes is in line with an underlying aim in this study to understand how socially supportive interactions might determine regular physical activity in terms of known social cognitive determinants of regular physical activity. Therefore social support is presented as a distal predictor that can influence proximate theory of planned behaviour variables (intention and perceived behavioural control) and post-intentional processes such as planning  ADDIN REFMGR.CITE Sniehotta200975Towards a theory of intentional behaviour change: Plans, planning, and self-regulationJournal75Towards a theory of intentional behaviour change: Plans, planning, and self-regulationSniehotta,F.F.2009/5COGNITIONSCONSTRUCTHEALTHIMPLEMENTATION INTENTIONSintentionINTENTIONSINTERVENTIONINTERVENTIONSMEDIATORMODERATORSplanningPLANSREASONED ACTIONself-regulationtheoryNot in File261273Br.J.Health Psychol.14Pt 2
University of Aberdeen, Aberdeen, UK
PM:19102817Br.J.Health Psychol.1
(Sniehotta, 2009). It is not entirely clear why gender differences have been observed in the link between social support and physical activity. One speculative hypothesis may be that it is due to the importance of agency as opposed to communion that are thought to characterise male and female (i.e. an intrapersonal versus interpersonal orientation, respectively) differences in social behaviour (Helgeson, 1994). In light of the previously observed gender differences  ADDIN REFMGR.CITE Sallis199269Predictors of Adoption and Maintenance of Vigorous Physical-Activity in Men and WomenJournal69Predictors of Adoption and Maintenance of Vigorous Physical-Activity in Men and WomenSallis,J.F.Hovell,M.F.Hofstetter,C.R.1992/3AdoptiondeterminantsExerciseFITNESSMAINTENANCEMENphysical activityPHYSICAL-ACTIVITYPREDICTORSTIMEWOMENNot in File237251Preventive Medicine2120091-7435
SAN DIEGO STATE UNIV,GRAD SCH PUBL HLTH,SAN DIEGO,CA 92182 SAN DIEGO STATE UNIV,DEPT POLIT SCI,SAN DIEGO,CA 92182
ISI:A1992HK68400008Preventive Medicine1
Sallis199963Potential mediators of change in a physical activity promotion course for university students: Project GRADJournal63Potential mediators of change in a physical activity promotion course for university students: Project GRADSallis,J.F.Calfas,K.J.Alcaraz,J.E.Gehrman,C.Johnson,M.F.1999=SPRBARRIERSBEHAVIORBEHAVIOR-CHANGEbehavioral medicineBENEFITSENJOYMENTExerciseFRIENDSHEALTHHEALTH BEHAVIORINTENSITYINTERVENTIONINTERVENTIONSMALESMEDIATORMENMODELMODELSPERFORMANCEphysical activityPHYSICAL-ACTIVITYPROGRAMREGRESSIONSELF-EFFICACYsocialSOCIAL SUPPORTSTUDENTSSUPPORTtheoryVARIABLESWOMENNot in File149158Annals of Behavioral Medicine2120883-6612
San Diego State Univ, Dept Psychol, San Diego, CA 92120 USA
ISI:000086106000007Annals of Behavioral Medicine1
(Sallis et al., 1992a; Sallis et al., 1999) we also examined whether gender may moderate the relationship between social support and physical activity. The main hypotheses for the present study however, was that the proximal predictors from the TPB (intention and perceived behavioural control) and planning variables (action and coping planning) would mediate any observed relationships between social support and regular physical activity. Method Design Data were collected as part of the Student Activity and Lifestyle at Aberdeen (SALSA) study, a prospective cohort study investigating levels and determinants of physical activity and other health behaviors amongst students of a Scottish university. Measurements used for the present analysis were taken in the first two weeks of the academic year (Time 1) and approximately 7 weeks later (Time 2) using a web-based questionnaire  ADDIN REFMGR.CITE Skar200836Prediction of behaviour vs. prediction of behaviour change: The role of motivational moderators in the theory of planned behaviour 4Journal36Prediction of behaviour vs. prediction of behaviour change: The role of motivational moderators in the theory of planned behaviour 4Skar,S.Sniehotta,F.F.raujo-Soares,V.Molloy,G.J.2008/10attitudesATTITUDINAL AMBIVALENCECARDIAC REHABILITATIONExerciseHEALTHintentionINTENTIONSLEISURE-TIMELIFEMETAANALYSISPERCEIVED DIFFICULTYPHYSICAL-ACTIVITYPREDICTIONQUESTIONNAIREREASONED ACTIONSELF-EFFICACYSTUDENTSVARIABLESNot in File609627Applied Psychology-An International Review-Psychologie Appliquee-Revue Internationale5740269-994X
Univ Aberdeen, Univ London Kings Coll, Coll Life Sci & Med, Aberdeen AB24 2UB, Scotland Robert Gordon Univ, Aberdeen AB9 1FR, Scotland Alliance Self Care Res, Alliance, OH USA UCL, London WC1E 6BT, England
ISI:000257702300005Applied Psychology-An International Review-Psychologie Appliquee-Revue Internationale1
(Skar et al., 2008). Participants and procedure All resident students of the university (approximately 10,000) received an email invitation to take part in the SALSA online study on a voluntary basis sent by the IT department at the beginning of the academic year. An email with a link to the follow-up questionnaire was sent 7 weeks later. Informed consent was given by 1,418 students. Of these, 887 were female (62.6%), mean age was 22.2 years (range 16 to 62 years), 93.7 per cent of the participants were 30 years old or younger. Ethical approval was granted by the University psychology ethics committee. Measures Physical activity Physical activity was measured at Time 1 and Time 2 using the Godin Leisure Time Exercise Questionnaire -LTEQ  ADDIN REFMGR.CITE Godin198543A simple method to assess exercise behavior in the community.Journal (Full)43A simple method to assess exercise behavior in the community.Godin,G.Shephard,R.J1985BEHAVIORExerciseEXERCISE BEHAVIORNot in File141146Canadian Journal of Applied Sport Sciences10Canadian Journal of Applied Sport Sciences32(Godin & Shephard, 1985). A measure of frequency of strenuous physical activity (e.g. heart beats rapidly) over the previous 7 days was used as the dependent variable. Godins LTEQ is one of the best studied self-report measures in both patient  ADDIN REFMGR.CITE Motl200846Physical activity, self-efficacy, and quality of life in multiple sclerosisJournal46Physical activity, self-efficacy, and quality of life in multiple sclerosisMotl,R.W.Snook,E.M.2008/2BEHAVIORCOMMUNITYDIAGNOSISExerciseHEALTH-STATUSIMPACTLEISURE-TIMELIFEMSmultiple sclerosisphysical activityPHYSICAL-ACTIVITYpsychologicalquality of lifeQUALITY-OF-LIFEQUESTIONNAIRESCALESELF-EFFICACYsocialsocial cognitiveSUPPORTVALIDITYNot in File111115Annals of Behavioral Medicine3510883-6612
Univ Illinois, Dept Kinesiol & Community Hlth, Urbana, IL 61801 USA
ISI:000253573900013Annals of Behavioral Medicine1
(Motl & Snook, 2008) and non-patient groups and has shown satisfactory concurrent validity against accelerometry measures (r>0.30)  ADDIN REFMGR.CITE Sallis200018Assessment of physical activity by self-report: Status, limitations, and future directionsJournal18Assessment of physical activity by self-report: Status, limitations, and future directionsSallis,J.F.Saelens,B.E.2000/6accelerometerACTIVITY PATTERNSACTIVITY QUESTIONNAIREASSOCIATIONHEALTHLIMITATIONSmeasurementOLDER CHILDRENphysical activityPHYSICAL-ACTIVITYPREVALENCEPUBLIC-HEALTHQUESTIONNAIRERECALLreliabilityVALIDATIONVALIDITYWOMENNot in FileS1S14Research Quarterly for Exercise and Sport7120270-1367
San Diego State Univ, Dept Psychol, San Diego, CA 92182 USA
ISI:000087868000002Research Quarterly for Exercise and Sport1
(Sallis & Saelens, 2000). Frequency of strenuous physical activity was chosen as the dependent variable for this study, as it has been shown to be most reflective of habitual physical activity when compared with more objective measures  ADDIN REFMGR.CITE Richardson200188Validation of the stanford 7-Day Recall to assess habitual physical activityJournal88Validation of the stanford 7-Day Recall to assess habitual physical activityRichardson,M.T.Ainsworth,B.E.Jacobs,D.R.Leon,A.S.2001/25-CITY PROJECTaccelerometerACTIVITY QUESTIONNAIREASSOCIATIONASSOCIATIONSDISEASEENERGY-EXPENDITUREExerciseexertionINTENSITYLEISURE-TIMEMENphysical activityphysical activity assessmentPHYSICAL-ACTIVITYPORTABLE ACCELEROMETERQUESTIONNAIRERECALLreliabilityRISK-FACTORSSEASONAL-VARIATIONTIMEVALIDATIONVALIDITYWOMENWORKNot in File145153Annals of Epidemiology1121047-2797
Univ Alabama, Coll Educ, Tuscaloosa, AL 35487 USA Univ S Carolina, Sch Publ Hlth, Dept Exercise Sci, Columbia, SC 29208 USA Univ S Carolina, Sch Publ Hlth, Dept Epidemiol & Biostat, Columbia, SC 29208 USA Univ Minnesota, Sch Publ Hlth, Div Epidemiol, Minneapolis, MN 55455 USA Univ Minnesota, Coll Educ & Human Dev, Sch Kinesiol & Leisure Studies, Div Kinesiol,Lab Physiol Hyg & Exercise Sci, Minneapolis, MN 55455 USA
ISI:000166827500009Annals of Epidemiology1
(Richardson et al., 2001). Theory of planned behavior The proximal predictors of behavior from the theory of planned behavior (a 3-item intention scale and a 4-item perceived behavioral control scale) were measured using the items used by Armitage  ADDIN REFMGR.CITE Armitage200567Can the theory of planned behavior predict the maintenance of physical activity?Journal67Can the theory of planned behavior predict the maintenance of physical activity?Armitage,C.J.2005/5ATTITUDEattitudesBEHAVIORExerciseEXERCISE BEHAVIOREXERCISE HABITShabitHEALTHHEALTH BEHAVIORintentionINTENTIONSINTERVENTIONINTERVENTIONSMAINTENANCEMETAANALYSISPARTICIPATIONPAST BEHAVIORPEOPLEPERCEPTIONSPERFORMANCEphysical activityPHYSICAL-ACTIVITYPLANNED BEHAVIORpsychologicalREASONED ACTIONRELAPSEsocialSTAGESURVIVAL ANALYSIStheorytheory of planned behaviorTIMETRANSITIONSTRANSTHEORETICAL MODELNot in File235245Health Psychology2430278-6133
Univ Sheffield, Ctr Res Social Attitudes, Dept Psychol, Sheffield S10 2TP, S Yorkshire, England
ISI:000230136200001Health Psychology1
(Armitage, 2005). The intention items were: How often do you intend to take part in regular physical activity? neverfrequently, and I want to exercise regularly definitely do notdefinitely do and an additional third intention item I do not intend to participate in regular physical activity disagree- agree. The perceived behavioural control items were: To what extent do you see yourself as being capable of participating in regular physical activity? incapablecapable; How confident are you that you will be able to participate in regular physical activity? not very confidentvery confident; I believe I have the ability to participate in regular physical activity. definitely do notdefinitely do; and How much personal control do you feel you have over participating in regular physical activity? no controlcomplete control. Both intention and perceived behavioural control were measured using 7 point scales. Planning Action planning was measured using a 5 item scale  ADDIN REFMGR.CITE Sniehotta200539Action planning and coping planning for long-term lifestyle change: Theory and assessment 9Journal39Action planning and coping planning for long-term lifestyle change: Theory and assessment 9Sniehotta,F.F.Schwarzer,R.Scholz,U.Schuz,B.2005/7ACTION PLANSBARRIERSBEHAVIORCOGNITIONSDISEASEExerciseGermanyHEALTHIMPLEMENTATION INTENTIONSintentionINTENTIONSINTERVENTIONINTERVENTIONSLIFEphysical exercisePHYSICAL-ACTIVITYplanningPLANSREHABILITATIONWOMENNot in File565576European Journal of Social Psychology3540046-2772
Univ Aberdeen, Coll Life Sci & Med, Sch Psychol, Kings Coll, Aberdeen AB24 2UB, Scotland Free Univ Berlin, D-1000 Berlin, Germany
ISI:000230837000008European Journal of Social Psychology1
(Sniehotta et al., 2005b). Items began with the stem I have made a detailed plan regarding when to participate in regular physical activity, ... where to participate in regular physical activity, ... how to participate in regular physical activity, how often to participate in regular physical activity, ... with whom to participate in regular physical activity. The responses to the 5 items were on a 7 point scale and ranged from 1 Disagree to 7 Agree. Coping planning was measured using a six item scale  ADDIN REFMGR.CITE Sniehotta200539Action planning and coping planning for long-term lifestyle change: Theory and assessment 9Journal39Action planning and coping planning for long-term lifestyle change: Theory and assessment 9Sniehotta,F.F.Schwarzer,R.Scholz,U.Schuz,B.2005/7ACTION PLANSBARRIERSBEHAVIORCOGNITIONSDISEASEExerciseGermanyHEALTHIMPLEMENTATION INTENTIONSintentionINTENTIONSINTERVENTIONINTERVENTIONSLIFEphysical exercisePHYSICAL-ACTIVITYplanningPLANSREHABILITATIONWOMENNot in File565576European Journal of Social Psychology3540046-2772
Univ Aberdeen, Coll Life Sci & Med, Sch Psychol, Kings Coll, Aberdeen AB24 2UB, Scotland Free Univ Berlin, D-1000 Berlin, Germany
ISI:000230837000008European Journal of Social Psychology1
(Sniehotta et al., 2005b). Items also began with the stem I have made a detailed plan regarding what to do if something interferes with my plans for regular physical activity, ... how to cope with possible setbacks from regular physical activity, what to do in difficult situations in order to act according to my intentions for regular physical activity, which good opportunities for participating in physical activity to take, when I have to pay extra attention to prevent lapses from participating in regular physical activity. The responses to the 5 items were on a 7 point scale and ranged from 1 Disagree to 7 Agree. Social support for regular physical activity Social support for physical activity was measured using a 3-item scale that was based on a previous measure  ADDIN REFMGR.CITE Sallis198776The Development of Scales to Measure Social Support for Diet and Exercise BehaviorsJournal76The Development of Scales to Measure Social Support for Diet and Exercise BehaviorsSallis,J.F.Grossman,R.M.Pinski,R.B.Patterson,T.L.Nader,P.R.1987/11BEHAVIORBEHAVIORSExerciseEXERCISE BEHAVIOREXERCISE BEHAVIORSSCALESCALESsocialSOCIAL SUPPORTSUPPORTTIMENot in File825836Preventive Medicine1660091-7435
SAN DIEGO STATE UNIV,DEPT PSYCHOL,SAN DIEGO,CA 92182
ISI:A1987L254600009Preventive Medicine1
(Sallis et al., 1987) and was designed to be concordant with the dependent physical activity measure in this study. The items began with the stem In the last week I.....had somebody to encourage me to participate in physical activity on a regular basis, ......had somebody to participate in physical activity with me, ........felt supported in having a regular pattern of physical activity. The responses to the 3 items were on a 7 point scale and ranged from 1 Disagree to 7 Agree. Statistical analysis Descriptive statistics were used to examine means, variability and bivariate correlations between the main study measures. Internal consistency for multi-item scales was calculated using Cronbachs alpha. In order to test whether there was an interaction between gender and social support, moderated regression analysis were carried out. A multiple regression model predicting physical activity at time 2 with physical activity at time 1, social support at time 1, gender and a social support by gender interaction term as predictors was carried out. Two multiple mediation analysis were employed to test firstly whether intention and perceived behavioral control and secondly action planning and coping planning significantly mediated the observed associations between social support and regular physical activity at time 2, adjusting for physical activity at time 1. All social cognitive variables used in this analysis were Time 1 measures. The total effect (weight c) of an independent variable (IV) on a dependent variable (DV) is composed of a direct effect (weight c) of the IV on the DV and an indirect effect (weight axb) of the IV on the DV through a proposed mediator (M). Weight a represents the effects of the IV on the M, whereas weight b is the effect of the M on the DV. In the case of multiple mediators, it is possible to estimate the total indirect effects as well as the specific indirect effects. This analysis was gender stratified following the test for interaction between gender and social support in the multiple regression model predicting physical activity at Time 2. The bootstrapping method outlined by Preacher & Hayes was employed with 5000 bootstrap samples to assess indirect effects  ADDIN REFMGR.CITE Preacher200857Asymptotic and resampling strategies for assessing and comparing indirect effects in multiple mediator modelsJournal57Asymptotic and resampling strategies for assessing and comparing indirect effects in multiple mediator modelsPreacher,K.J.Hayes,A.F.2008/8affectCONFIDENCE-INTERVALSINTERVENTIONLIMITSMEDIATORMODELMODELSPERFORMANCEPRODUCTPROGRAMSATISFACTIONSOCIALIZATIONSTRATEGIESSTRUCTURAL-EQUATION MODELSNot in File879891Behavior Research Methods4031554-351X
Univ Kansas, Dept Psychol, Lawrence, KS 66045 USA Ohio State Univ, Columbus, OH 43210 USA
ISI:000257991700027Behavior Research Methods1
(Preacher & Hayes, 2008). The analysis was conducted using SPSS 16 and the multiple mediation macro for SPSS that has been developed by Preacher & Hayes (2008). Results Dropout Analysis Out of the 1,418 participants at baseline, 903 (63.6%) completed the follow-up. Comparisons between variables under investigation revealed that participants that dropped out of the study were not significantly different in terms of age, time 1 levels of Physical activity, PBC or social support. Male participants were more likely to drop out (42%) than females (33%), p = 0.001. Descriptive Statistics Table 1 presents means, standard deviations and correlations for the study variables. All variables correlated significantly at the p< .01 level. Cronbachs alphas are presented in table 1 and were satisfactory and comparable to the previous studies  ADDIN REFMGR.CITE Armitage200567Can the theory of planned behavior predict the maintenance of physical activity?Journal67Can the theory of planned behavior predict the maintenance of physical activity?Armitage,C.J.2005/5ATTITUDEattitudesBEHAVIORExerciseEXERCISE BEHAVIOREXERCISE HABITShabitHEALTHHEALTH BEHAVIORintentionINTENTIONSINTERVENTIONINTERVENTIONSMAINTENANCEMETAANALYSISPARTICIPATIONPAST BEHAVIORPEOPLEPERCEPTIONSPERFORMANCEphysical activityPHYSICAL-ACTIVITYPLANNED BEHAVIORpsychologicalREASONED ACTIONRELAPSEsocialSTAGESURVIVAL ANALYSIStheorytheory of planned behaviorTIMETRANSITIONSTRANSTHEORETICAL MODELNot in File235245Health Psychology2430278-6133
Univ Sheffield, Ctr Res Social Attitudes, Dept Psychol, Sheffield S10 2TP, S Yorkshire, England
ISI:000230136200001Health Psychology1
Sniehotta200539Action planning and coping planning for long-term lifestyle change: Theory and assessment 9Journal39Action planning and coping planning for long-term lifestyle change: Theory and assessment 9Sniehotta,F.F.Schwarzer,R.Scholz,U.Schuz,B.2005/7ACTION PLANSBARRIERSBEHAVIORCOGNITIONSDISEASEExerciseGermanyHEALTHIMPLEMENTATION INTENTIONSintentionINTENTIONSINTERVENTIONINTERVENTIONSLIFEphysical exercisePHYSICAL-ACTIVITYplanningPLANSREHABILITATIONWOMENNot in File565576European Journal of Social Psychology3540046-2772
Univ Aberdeen, Coll Life Sci & Med, Sch Psychol, Kings Coll, Aberdeen AB24 2UB, Scotland Free Univ Berlin, D-1000 Berlin, Germany
ISI:000230837000008European Journal of Social Psychology1
(Armitage, 2005; Sniehotta et al., 2005b). All observed correlations were in the predicted direction and were consistent with previous research  ADDIN REFMGR.CITE Courneya20009Social support and the theory of planned behavior in the exercise domainJournal9Social support and the theory of planned behavior in the exercise domainCourneya,K.S.Plotnikoff,R.C.Hotz,S.B.Birkett,N.J.2000/7ADHERENCEADULTSattitudesBEHAVIORCOMMUNITYdemographicDOMAINExerciseEXERCISE INTENTIONIDENTIFYintentionINTENTIONSMODELPHYSICAL-ACTIVITYPLANNED BEHAVIORPREDICTIONREGULAR EXERCISEsocialSOCIAL SUPPORTSUPPORTtheory of planned behaviorNot in File300308American Journal of Health Behavior2441087-3244
Univ Alberta, Fac Phys Educ, Van Vliet Ctr E401, Edmonton, AB T6G 2H9, Canada Univ Alberta, Alberta Ctr Well Being, Ctr Hlth Promot Studies, Edmonton, AB T6G 2H9, Canada Univ Ottawa, Fac Med, Dept Epidemiol & Community Med, Ottawa, ON K1N 6N5, Canada Univ Ottawa, Sch Psychol, Ottawa, ON K1N 6N5, Canada
ISI:000087954700006American Journal of Health Behavior1
(Courneya et al., 2000). Moderation analysis Table 2 presents the results of the moderated regression analysis. As indicated in Table 2 the gender by social support interaction term was statistically significant. To probe the gender by social support interaction we plotted regression lines of best fit at high (one standard deviation above the mean) and low levels (one standard deviation below the mean) of social support for men and women. Next, we conducted further tests separately on the male and female lines to determine whether they differed from zero. This revealed that the line for women differed significantly from zero ( =0.146, t =3.716, p < .001), but the line for men did not ( =-0.008, t = -0.148, p =0.882). As illustrated in Fig.1, physical activity at Time 2 was significantly lower among women who had lower levels of social support. Mediation analysis The gender stratified mediation analysis is summarized in Table 3. In men greater social support for physical activity was associated with higher levels of PBC. Higher levels of PBC were associated with more physical activity at Time 2. The indirect effect of social support for physical activity through PBC was statistically significant for men. Social support for physical activity was associated with action planning, however there were no associations between action and coping planning and physical activity at Time 2 in men. The total effect of social support for physical activity at Time 1 on physical activity at Time 2 was not statistically significant for men. For women greater social support for physical activity was associated with stronger intentions and higher PBC and higher PBC was associated more physical activity at Time 2. The indirect effect of social support for physical activity at Time 2 through PBC was statistically significant for women. Social support for physical activity was associated with action and coping planning, while only coping planning was associated with physical activity at Time 2 in women. The indirect effect of social support for physical activity through coping planning was statistically significant for coping planning only; however the size of the indirect effect was almost identical for action planning. The total effect of social support for physical activity at Time 1 on physical activity at Time 2 was statistically significant for women. In summary the analysis shows that, as expected, perceived behavioral control was a partial mediator of the relationship between social support for physical activity and physical activity at Time 2 . The multiple mediation model for women also showed that coping planning was a significant partial mediator of the social support-physical activity relationship. Discussion The present study found that enhanced coping planning may partly explain the social support-physical activity link in women. This study also confirmed previous findings showing that the relationship between social support for physical activity and physical activity can be partly explained by control beliefs. Specifically perceived behavioural control from the theory of planned behaviour partly mediated the effect of social support on regular physical activity in prospective analysis in both men and women, mirroring previous findings  ADDIN REFMGR.CITE Courneya199510Cognitive Mediators of the Social-Influence Exercise Adherence Relationship - A Test of the Theory of Planned BehaviorJournal10Cognitive Mediators of the Social-Influence Exercise Adherence Relationship - A Test of the Theory of Planned BehaviorCourneya,K.S.McAuley,E.1995/10ADHERENCEattitudesBEHAVIORCOHESIONCONSTRUCTExerciseEXERCISE ADHERENCEGROUP COHESIONintentionINTENTIONSPHYSICAL-ACTIVITYPLANNED BEHAVIORPREDICTIONsocialSOCIAL SUPPORTSUBJECTIVE NORMSUPPORTtheory of planned behaviorNot in File499515Journal of Behavioral Medicine1850160-7715
UNIV ILLINOIS,URBANA,IL 61801
ISI:A1995RX84300006Journal of Behavioral Medicine1
(Courneya & McAuley, 1995). As we have already mentioned in the introduction this is consistent with socially facilitated behaviour change techniques such as verbal persuation and modelling that are known to enhance beliefs about control over behaviour (Bandura, 1997). Social support for physical activity by defintion includes having someone to engage in physical activity with and someone to encourage you to engage in physical activity, which should, according to the social cognitive theory (Bandura, 1997), have a positive impact on beliefs about control over this behaviour. The study findings also highlight once again that social support is a more powerful determinant of regular physical activity for women than men  ADDIN REFMGR.CITE Sallis199269Predictors of Adoption and Maintenance of Vigorous Physical-Activity in Men and WomenJournal69Predictors of Adoption and Maintenance of Vigorous Physical-Activity in Men and WomenSallis,J.F.Hovell,M.F.Hofstetter,C.R.1992/3AdoptiondeterminantsExerciseFITNESSMAINTENANCEMENphysical activityPHYSICAL-ACTIVITYPREDICTORSTIMEWOMENNot in File237251Preventive Medicine2120091-7435
SAN DIEGO STATE UNIV,GRAD SCH PUBL HLTH,SAN DIEGO,CA 92182 SAN DIEGO STATE UNIV,DEPT POLIT SCI,SAN DIEGO,CA 92182
ISI:A1992HK68400008Preventive Medicine1
(Sallis et al., 1992a). This suggests that research and practice in this area should clearly consider the role of gender differences in understanding the determinants of the adoption and maintenance of regular physical activity. Although it is difficult to conceive of interventions that aim to increase physical activity that do not either implicitly or explicitly include a social supportive component, particularly where researchers interact with participants, it is likely that socially supportive interventions for women will be more efficacious than for men. The non-significant total effect of social support on physical activity for men could have been the result of a suppression effect of some of the other social cognitive variables. As shown in the results, intention was negatively associated with PA and thereby suppressed the social support and physical activity association. This suppression could have "suppressed" the positive mediated effect of PBC, which when combined could have resulted in a non-significant total effect. Therefore it is important to interpret the results for the male sub-sample in this study with caution. The finding in the present study showing that coping planning partly explains the relationship between social support and physical activity in women may shed some new light in understanding this relationship. One recent intervention study in breast cancer survivors that involved theory based information and pedometer self-monitoring intervention to enhance physical activity found that action planning was improved in the intervention group  ADDIN REFMGR.CITE Vallance200877Analyzing theoretical mechanisms of physical activity behavior change in breast cancer survivors: Results from the activity promotion (ACTION) trialJournal77Analyzing theoretical mechanisms of physical activity behavior change in breast cancer survivors: Results from the activity promotion (ACTION) trialVallance,J.K.H.Courneya,K.S.Plotnikoff,R.C.Mackey,J.R.2008/4ATTITUDEBEHAVIORbehavior changeBEHAVIOR-CHANGEBREASTbreast cancer survivorsBREAST-CANCERcancercancer survivorsCLINICAL-TRIALSCONSTRUCTDIAGNOSISEXERCISE BEHAVIORHEALTHIMPLEMENTATION INTENTIONSintentionINTERVENTIONINTERVENTIONSLIFEPARTICIPATIONphysical activityPHYSICAL-ACTIVITYPLANNED BEHAVIORplanningPROMOTIONPUBLIC-HEALTHQUALITYquality of lifeQUALITY-OF-LIFERANDOMIZED CONTROLLED-TRIALSURVIVORStheorytheory of planned behaviorTIMETRIALVARIABLESNot in File150158Annals of Behavioral Medicine3520883-6612
Univ Alberta, Fac Phys Educ & Recreat, Edmonton, AB T6G 2H9, Canada Univ Alberta, Sch Publ Hlth, Ctr Hlth Promot Studies, Edmonton, AB T6G 2T4, Canada Cross Canc Inst, Dept Oncol, Edmonton, AB T6G 1Z2, Canada
ISI:000255057600003Annals of Behavioral Medicine1
(Vallance et al., 2008). As this study implicitly involved social support for physical activity beyond that which would have otherwise available i.e. support from those delivering the behaviour change intervention, this intervention has clearly a social support component. As the results in the Vallance et al. (2008) study indicate it is possible that social support for physical activity may facilitate the formation of plans and in particular plans to overcome the barriers that can prevent individuals from taking part in regular physical activity, i.e. coping planning. Although Vallance et al. (2008) did not include a measure of coping planning in their study, it is clear that action and coping planning are indeed distinct but highly correlated constructs e.g. in the present study r=0.67, and it is possible that an intervention that had an influence on action planning may have also had an effect on coping planning. Action planning and coping planning as they are currently conceived are not interpersonal but intra-individual processes. Future work should consider how these processes play out in a more social, particularly dyadic context. The dyad is of interest for three key reasons. Firstly most humans live and function in a limited number of ongoing dyadic relationships of some description for large parts of their lives e.g. mother-child, spousal pair relationship, informal caregiver to elderly parent  ADDIN REFMGR.CITE Baumeister199579The Need to Belong - Desire for Interpersonal Attachments As A Fundamental Human-MotivationJournal79The Need to Belong - Desire for Interpersonal Attachments As A Fundamental Human-MotivationBaumeister,R.F.Leary,M.R.1995/5CLOSE RELATIONSHIPSEMOTIONAL LONELINESSEXCHANGE RELATIONSHIPSHEALTHIN-GROUPINTERGROUP BEHAVIORMARITAL QUALITYmotivationOUT-GROUPPATTERNSPEOPLEpsychologicalSELF-ESTEEMSEX-DIFFERENCESsocialSOCIAL SUPPORTSUPPORTTIMENot in File497529Psychological Bulletin11730033-2909
WAKE FOREST UNIV,DEPT PSYCHOL,WINSTON SALEM,NC 27109
ISI:A1995QX81500009Psychological Bulletin1
(Baumeister & Leary, 1995). Therefore co-regulatory processes  ADDIN REFMGR.CITE Sbarra200880Coregulation, dysregulation, self-regulation: An integrative analysis and empirical agenda for understanding adult attachment, separation, loss, and recoveryJournal80Coregulation, dysregulation, self-regulation: An integrative analysis and empirical agenda for understanding adult attachment, separation, loss, and recoverySbarra,D.A.Hazan,C.2008/5adult attachmentBLOOD-PRESSURECHRONIC STRESScoregulationcytokinesGUINEA-PIG PUPSINDUCED SICKNESS BEHAVIORSKILLER-CELL-ACTIVITYlossMODELoxytocinPHYSIOLOGICAL PROCESSESPOSITIVE GAY MENpsychologicalPSYCHOLOGICAL DISTRESSpsychophysiologyrecoveryself-regulationseparationSOCIAL RELATIONSHIPSSTRATEGIESSTRESSTASKTHEORETICAL INTEGRATIONTIMENot in File141167Personality and Social Psychology Review1221088-8683
Dept Psychol, Tucson, AZ 85721 USA Cornell Univ, Ithaca, NY 14853 USA
ISI:000255312100003Personality and Social Psychology Review1
(Saxbe & Repetti, 2010; Sbarra & Hazan, 2008), as opposed to self-regulatory processes, may be critical determinants for understanding the adoption and maintenance of key health behaviours. Behavioural co-regulation in this context refers to the process whereby each individual in a relationship serves as the primary behavioural regulator for their partner. Secondly there is some evidence that collaborative planning can lead to greater behaviour change than individual planning  ADDIN REFMGR.CITE Prestwich200581Individual and collaborative implementation intentions and the promotion of breast self-examinationJournal81Individual and collaborative implementation intentions and the promotion of breast self-examinationPrestwich,A.Conner,M.Lawton,R.Bailey,W.Litman,J.Molyneaux,V.2005/12BEHAVIORBREASTbreast self-examinationcancercollaborative implementation intentionsEDUCATIONefficacyGOALHEALTHIMPACTIMPLEMENTATION INTENTIONSINCOMEintentionINTENTIONSINTERVENTIONINTERVENTIONSKNOWLEDGEpartner supportPERFORMANCEplanningPLANSPROMOTIONPROTECTION-MOTIVATION THEORYSTRATEGIESTIMEWOMENNot in File743760Psychology & Health2060887-0446
Univ Essex, Dept Psychol, Colchester CO4 3SQ, Essex, England Univ Leeds, Inst Psychol Sci, Leeds LS2 9JT, W Yorkshire, England
ISI:000233748100004Psychology & Health1
(Prestwich et al., 2005). Finally the dyad offers an under examined target for intervention and a new unit for analysis that could potentially enhance the science and practice of physical activity behaviour change. These approaches could help bridge the theoretical gap between interpersonal contexts e.g. social supportive interactions, and the self-regulation of regular physical activity. It is important to note that social exchange processes in relations to health behaviour have been studied for some time (Lewis & Rook, 1999; Umberson, 1992), however this literature has been somewhat separate of work on the self-regulation of health behaviour, particularly work focusing on social cognitive processes. Other recent relevant evidence from a systematic review and meta-analysis of intervention studies which aimed to increase self-efficacy for physical activity found that physical activity self-efficacy was higher when vicarious experience was included as an intervention technique compared to those studies where it was not (Ashford, Edmunds & French, in press). These findings raise the question about whether more socially interactive behaviour change techniques for physical activity e.g. behavioural modelling, are potentially more efficacious than individual based techniques that do not include a socially interactive component. Duncan et al.s (2005) definition of social support would suggest that this type of intervention could also be categorised as a social support intervention for physical activity i.e. social support refers to any behavior that assists an individual in achieving desired goals or outcomes. Future systematic reviews and meta-analyses could examine whether behaviour change is greater when socially supportive behaviour change interventions are used compared to when they are not to begin to answer this question in the context of enhancing physical activity. Finally future studies should also aim to identify which kinds of social support e.g. emotional support, practical/tangible support or companionship are most important for which kinds of physical activity. This work would be particularly important for developing social support interventions for given behaviours. There are of course a number of limitations to present study, which should be highlighted. Firstly the correlational design precludes causal inferences. This is a common issue in observational health behaviour studies, which should be given due consideration  ADDIN REFMGR.CITE Weinstein200782Misleading tests of health behavior theoriesJournal82Misleading tests of health behavior theoriesWeinstein,N.D.2007ADHERENCEaffectATTITUDEBEHAVIORBEHAVIORSBELIEF MODELCONSTRUCTExerciseFEAR APPEALSHEALTHHEALTH BEHAVIORINTENTIONSINTERVENTIONINTERVENTIONSMETAANALYSISPERSPECTIVEPLANNED BEHAVIORPROGRAMProtection motivation theoryREASONED ACTIONRISK PERCEPTIONSSTRATEGIESSUPPORTTESTStheoryTIMEVALIDITYNot in File110Annals of Behavioral Medicine3310883-6612
Rutgers State Univ, Dept Human Ecol, Piscataway, NJ 08855 USA
ISI:000244464800001Annals of Behavioral Medicine1
(Weinstein, 2007). Secondly the student sample may prevent generalisation, however such samples are frequently used in key studies  ADDIN REFMGR.CITE Sallis199963Potential mediators of change in a physical activity promotion course for university students: Project GRADJournal63Potential mediators of change in a physical activity promotion course for university students: Project GRADSallis,J.F.Calfas,K.J.Alcaraz,J.E.Gehrman,C.Johnson,M.F.1999=SPRBARRIERSBEHAVIORBEHAVIOR-CHANGEbehavioral medicineBENEFITSENJOYMENTExerciseFRIENDSHEALTHHEALTH BEHAVIORINTENSITYINTERVENTIONINTERVENTIONSMALESMEDIATORMENMODELMODELSPERFORMANCEphysical activityPHYSICAL-ACTIVITYPROGRAMREGRESSIONSELF-EFFICACYsocialSOCIAL SUPPORTSTUDENTSSUPPORTtheoryVARIABLESWOMENNot in File149158Annals of Behavioral Medicine2120883-6612
San Diego State Univ, Dept Psychol, San Diego, CA 92120 USA
ISI:000086106000007Annals of Behavioral Medicine1
(Sallis et al., 1999) that attempt to answer important questions about the psychosocial determinants of health behaviour. A further point in relation to the study sample concerns the fact that there was a smaller sample of men than women in this study. It is worth considering that observed gender differences in social support, social cognitive and physical activity associations may be due to differential statistical power in the analysis of these two sub-groups. Finally corroborating self-report physical activity data with accelerometer or other more objective data always provides a more compelling set of findings. Nevertheless the present analysis throws some new light on the relationship between social support for physical activity and subsequent physical activity by confirming the role of perceived behavioural control and identifying coping planning as a potential mediator of this relationship. Conclusion These findings highlight the importance of interpersonal processes in understanding the social cognitive determinants of regular physical activity. It is likely that planning processes relating to physical activity are often influenced by those in the ongoing immediate social environment. Future development of theory and interventions should take account of the socially interactive nature of planning processes. In particular a greater emphasis on how physical activity behaviour may be as much a problem of co-regulatory as opposed to self-regulatory processes.  ADDIN REFMGR.REFLIST Reference List Ajzen, I. (1991). The Theory of Planned Behavior. Organizational Behavior and Human Decision Processes, 50, 179-211. Araujo-Soares, V., McIntyre, T., & Sniehotta, F. F. (2009). Predicting changes in physical activity among adolescents: the role of self-efficacy, intention, action planning and coping planning. Health Education Research, 24, 128-139. Armitage, C. J. (2005). Can the theory of planned behavior predict the maintenance of physical activity? Health Psychology, 24, 235-245. Ashford, S., Edmunds, J., & French, D.P. (in press). What is the best way to change self-efficacy to promote lifestyle and recreational physical activity? A systematic review with meta-analysis. British Journa l of Health Psychology, Bandura, A. (1997). Self-efficacy: The exercise of control. New York: WH Freeman. Bandura, A. (2004). Health promotion by social cognitive means. Health Education & Behavior, 31, 143-164. Baumeister, R. F. & Leary, M. R. (1995). The need to belong - desire for interpersonal attachments as a fundamental human-motivation. Psychological Bulletin, 117, 497-529. Courneya, K. S. & McAuley, E. (1995). Cognitive mediators of the social-influence exercise adherence relationship - a test of the theory of planned behavior. Journal of Behavioral Medicine, 18, 499-515. Courneya, K. S., Plotnikoff, R. C., Hotz, S. B., & Birkett, N. J. (2000). Social support and the theory of planned behavior in the exercise domain. American Journal of Health Behavior, 24, 300-308. Godin, G. & Shephard, R. J. (1985). A simple method to assess exercise behavior in the community. Canadian Journal of Applied Sport Sciences, 10, 141-146. Helegeson, V.S. (1994). Relation of agency and communion to well-being: Evidence and potential explanations. Psychological Bulletin, 116, 412-428. Lewis, M.A. & Rook, K.S. (1999). Social control in personal relationships: Impact on health behaviors and psychological distress. Health Psychology, 18, 63-71. McAuley, E., Jerome, G. J., Marquez, D. X., Elavsky, S., & Blissmer, B. (2003). Exercise self-efficacy in older adults: Social, affective, and behavioral influences. Annals of Behavioral Medicine, 25, 1-7. Motl, R. W. & Snook, E. M. (2008). Physical activity, self-efficacy, and quality of life in multiple sclerosis. Annals of Behavioral Medicine, 35, 111-115. Preacher, K. J. & Hayes, A. F. (2008). Asymptotic and resampling strategies for assessing and comparing indirect effects in multiple mediator models. Behavior Research Methods, 40, 879-891. Prestwich, A., Conner, M., Lawton, R., Bailey, W., Litman, J., & Molyneaux, V. (2005). Individual and collaborative implementation intentions and the promotion of breast self-examination. Psychology & Health, 20, 743-760. Richardson, M. T., Ainsworth, B. E., Jacobs, D. R., & Leon, A. S. (2001). Validation of the stanford 7-Day Recall to assess habitual physical activity. Annals of Epidemiology, 11, 145-153. Sallis, J. F., Calfas, K. J., Alcaraz, J. E., Gehrman, C., & Johnson, M. F. (1999). Potential mediators of change in a physical activity promotion course for university students: Project GRAD. Annals of Behavioral Medicine, 21, 149-158. Sallis, J. F., Grossman, R. M., Pinski, R. B., Patterson, T. L., & Nader, P. R. (1987). The development of scales to measure social support for diet and exercise behaviors. Preventive Medicine, 16, 825-836. Sallis, J. F., Hovell, M. F., & Hofstetter, C. R. (1992a). Predictors of adoption and maintenance of vigorous physical-activity in men and women. Preventive Medicine, 21, 237-251. Sallis, J. F., Hovell, M. F., Hofstetter, C. R., & Barrington, E. (1992b). Explanation of vigorous physical-activity during 2 years using social-learning variables. Social Science & Medicine, 34, 25-32. Sallis, J. F. & Saelens, B. E. (2000). Assessment of physical activity by self-report: Status, limitations, and future directions. Research Quarterly for Exercise and Sport, 71, S1-S14. Saxbe, D & Repetti, R.L. (2010). For Better or Worse? Coregulation of couples cortisol levels and mood states. Journal of Personality & Social Psychology, 98, 92-103. Sbarra, D. A. & Hazan, C. (2008). Coregulation, dysregulation, self-regulation: An integrative analysis and empirical agenda for understanding adult attachment, separation, loss, and recovery. Personality and Social Psychology Review, 12, 141-167. Schwarzer, R., Schuz, B., Ziegelmann, J. P., Lippke, S., Luszczynska, A., & Scholz, U. (2007). Adoption and maintenance of four health behaviors: Theory-guided longitudinal studies on dental flossing, seat belt use, dietary behavior, and physical activity. Annals of Behavioral Medicine, 33, 156-166. Skar, S., Sniehotta, F. F., raujo-Soares, V., & Molloy, G. J. (2008). Prediction of behaviour vs. prediction of behaviour change: The role of motivational moderators in the theory of planned behaviour. Applied Psychology-An International Review, 57, 609-627. Sniehotta, F. F. (2009). Towards a theory of intentional behaviour change: Plans, planning, and self-regulation. British Journal of Health Psychology, 14, 261-273. Sniehotta, F. F., Scholz, U., & Schwarzer, R. (2006). Action plans and coping plans for physical exercise: A longitudinal intervention study in cardiac rehabilitation. British Journal of Health Psychology, 11, 23-37. Sniehotta, F. F., Scholz, U., Schwarzer, R., Fuhrmann, B., Kiwus, U., & Voller, H. (2005a). Long-term effects of two psychological interventions on physical exercise and self-regulation following coronary rehabilitation. International Journal of Behavioral Medicine, 12, 244-255. Sniehotta, F. F., Schwarzer, R., Scholz, U., & Schuz, B. (2005b). Action planning and coping planning for long-term lifestyle change: Theory and assessment. European Journal of Social Psychology, 35, 565-576. Trost, S. G., Owen, N., Bauman, A. E., Sallis, J. F., & Brown, W. (2002). Correlates of adults' participation in physical activity: review and update. Medicine and Science in Sports and Exercise, 34, 1996-2001. Uchino, B.N. (2009). Understanding the links between social support and physical health: A life-span perspective with emphais on the separability of perceived and received support. Perspectives on Psychological Science, 4, 236-255. Umberson, D. (1992). Gender, marital status and the social control of health behavior. Social Science & Medicine, 34, 907917. Vallance, J. K. H., Courneya, K. S., Plotnikoff, R. C., & Mackey, J. R. (2008). Analyzing theoretical mechanisms of physical activity behavior change in breast cancer survivors: Results from the activity promotion (ACTION) trial. Annals of Behavioral Medicine, 35, 150-158. Weinstein, N. D. (2007). Misleading tests of health behavior theories. Annals of Behavioral Medicine, 33, 1-10. Table 1 Correlation of physical activity, social support, theory of planned behaviour and planning. Mean (SD)Cronbachs alphaRangePhysical activity Time 12.17 (2.39)n.a0-101Physical activity Time 22.19 (2.46)n.a.0-10.68**1Social support Time 13.31 (1.93)0.811-7.34**.29**1PBC Time 15.45 (1.34)0.901-7.43**.42**.32**1Intention Time 15.76 (1.18)0.721-7.38**.34**.28**.68**1Action planning Time 13.36 (1.97)0.951-7.36**.32**.33**.40**.40**1Coping planning Time 12.51 (1.60)0.951-7.35**.34**.28**.29**.24**.67****P<0.01, PBC: Perceived behavioral control. Table 2 Multiple regression analysis testing the moderating effect of gender on the social support and physical activity at Time 2, controlling for physical activity at Time 1.  B 95% CI for B Std. ErrorStandardized Coefficient Beta PPhysical activity Time 1.678.625.732.027.650<.001Social support Time 1 (centered)-.163-.390.065.116-.128.161Gender (1 is male, 2 is female)-.258-.515.001.131-.050.050Gender X Social support Time 1 (centered).154.025.284.066.211.020 Note. Adjusted R2= 0.47, F (4, 891) =197.335, p<0.001. Table 3 Summary of prospective mediation analysis for social support, TPB variables, planning and physical activity for men and women (5000 bootstrap samples). Independent variable (IV)Mediating variable (M)Dependent variable (DV)Effect of IV on M (a)Effect of M on DV (b)Direct effects (c)Indirect effect (a x b) [95% BC CIs]Total effects (c) [Mediation]MEN Social support T1Intention T1Physical Activity T2.063-.300*-.037-.019 [-.061, -.001].002 [None]PBC T1.121**.471**-------------.057*[.020, .117] [Partial]Social support T1Action planning T1Physical Activity T2.130*.030-.003.004 [-.014, .036].003 [None]Coping planning T1.064.044-------------.002 [-.001, .030] [None]WOMENSocial support T1Intention T1Physical Activity T2.112**.085.112**.010 [-.001, .030].143** [None]PBC T1.122**.169*-------------.021*[ .003, .045] [Partial]Social support T1Action planning T1Physical Activity T2.282**.071.100*.020 [-.001, .053].140** [None]Coping planning T1.161**.123*-------------.020*[.001, .047] [Partial]* P <0.05, ** P<0.01. T1: Time 1, T2: Time 2, PBC: Perceived behavioral control, 95% BC CIs: 95% Bias corrected confidence intervals. Mediation models included Physical Activity T1 as a covariate.  T1: Time 1, T2: Time 2. Figure 1. The moderating effect of gender on the relationship between social support and physical activity.     Social support for physical activity. PAGE  PAGE 1 >?QYl _ ` a m n    3 5 < > F H O f ٿٿٖٖh[IhSomH nH sH tH h,=hSomH sH  hthSohSo h7hSohSomH nH sH tH h>hSomH nH sH tH h7hSomH sH hSomH sH h hSo5mH sH h7x5mH sH hSo5mH sH 4<=> ` a n 6 z dgd:#gdSo d7$8$H$gdSoddd7$8$H$gdSodgdSo $da$gdSo  @   * 4 6 ? G J w ߿߿߷߯ߧ꜔yqyiaiyiyhUmH sH h6mH sH hpWkmH sH h6h6mH sH hZCmH sH hlmH sH h:mH sH hlhlmH sH h-CmH sH hpWkmH sH hecmH sH h mH sH h mH sH hwXmH sH hlmH sH h6h.&^mH sH h6h.&^5mH sH h:5mH sH #     ! " # ) 4 6 G M y '+,12MŹxxpxxexZxh6h2.mH sH h6hVmH sH hecmH sH h6h.&^mH sH h6h]emH sH h2.mH sH hGmH sH hGmH sH hGhGmH sH hUOmH sH h6h.&^5mH sH h -mH sH hGmH sH hsmH sH hGmH sH h6h6mH sH h6mH sH hwXmH sH #MWXgi m}6CQ'./KLʿzrje^ZVZRZhkMh/hz hzhz hz5hpWkmH sH hmH sH h6MmH sH ho_]mH sH h /mH sH homH sH hn]mH sH h33mH sH h:5mH sH h6h.&^5mH sH h6h.&^mH sH hUmH sH hsmH sH h6h]emH sH hP >mH sH hSmH sH h6hVmH sH ]‘d{ToT] d7$8$H$gdf d7$8$H$gd d7$8$H$gd:# d`gd! d7$8$H$gdaf d7$8$H$gd=dgd:#Lefg&&&&&&}'''((( (((9(:(L(](^(_(///////K=L=w=x=z={===>1>E>M>X>>>>EEFF%F&F'FQMRMaMbMMMMSSSSTTTXٽhkhkMh7 hqhOhw9h)Lh Kh~)h2.hnEh%@ hBphBphBph~hwpjhwpUh/hT~DXXXYYYYyYYYYYYYZCZ[Z\ZZZZZ\\ ] ] ]]]]]]]]]]]dddddddeeee e(e=e>eBeKeYeȺȳȬȥ h=h| h=h|; h=h5Y3 h=h$ h=h$b h=hAO h=h; h=h5i h=h h=hqhIhu#h |h8Khe(h'nhsh|hqhwpjhwpU6Yedeeeejjjjj:kYkZk[k\krrrrrratbtct||||||| }}}#}?}@}BC[\`ôÅ~w~p~ h=hd= h=h>E h=h$b h=h$hwpmH nH sH tH jhwpUmH nH sH tH h=mH nH sH tH h=h=mH nH sH tH  h=hWI h=h] h=h5Y3 h=h|hwpjhwpU h=h\cy h=hAO h=h&:+͇‘Ñݑ5BϗЗȘؘۘô}}qeqeYeYhfmH nH sH tH h=mH nH sH tH h8KmH nH sH tH hwpmH nH sH tH jhwpUmH nH sH tH hafhsmH nH sH tH hafmH nH sH tH hafhafmH nH sH tH  hafhaf hafhe( h=hq h=hafhwpjhwpU h=h h=h$b h=hE4" 8=cde/>@isۛ @Q]xyz{ '9W[踴}yuqmuhYhPXhkhb7hshImH sH h!hohIh]hhQ0}hkMh$hfhSmh$bh|he(mH nH sH tH h^mH nH sH tH hnEmH nH sH tH hGmH nH sH tH hfmH nH sH tH h=mH nH sH tH *[u !BNOQÞĞƞҞ՞ mnLMN˥ޥ4;FQ_etȸܨФШببhGhshGh-v1h[mH nH sH tH jh[UmH nH sH tH h[hsh!hah<3hi2h^hhPXh)hYhkhb7hI=t}25`aԴմ!noڶ۶*02KL<=PQûhwpjhwpUh1h`7yh{vh6M\hkM h~h6Mh6Mh~h6M6 h6M5h6Mh6M5 hzh|hWhsjhGUh!hsh!mH sH hshGmH sH hGhGh^3QSTof#)*+Ki()=>Uq|O^$?@IRX\]fήhh&:]hh -]hhz]hh?]hhq]hnEhjKhG YhwpjhwpUh#hRXhkM h~h6Mh~h6M6h6Mh1>"#.KRcdqrsyzzzj]zhf6mH nH sH tH hfhf6mH nH sH tH hfmH nH sH tH "hh6]mH nH sH tH hmH nH sH tH hhmH nH sH tH  hf]hh]hhS] hwp]jhwpU]hh#]hhq]hhz]hh&:]hh -]$} Zkly5DST]mbeMb3S忺yyy hU69aJhU69hU69aJh00HhU696hU69B*aJph hU69\hwpjhwpUhU69h# h -hq hRX]hfhf]hfmH nH sH tH "hfhf6]mH nH sH tH hfhfmH nH sH tH hRXmH nH sH tH / )KU/7Imnx78MNvz79wy 45ԹԹԹhRXh6MaJ hRXh6Mhoh00Hh6M6 hM h6M h00Hh6Mhf&hwpjhwpUh&:h6Mh~h6M6 h)Lh6MhQ0}hRXh00HhU696hU69B*aJph hU69aJ hU695 hU69hU69hU691]I 5 hpG-[-117C9N9CoN]z d`gd# d`gd:# d7$8$H$gd2 d`gdAdgd:# d7$8$H$gd:#5=CVW'-9>^_d            ! " # $      2 9 z { |     aeghwpjhwpUh'hsh\FBh]2hChI>hAhGh&*ph9)hRXh&:hThGghop;*?^_$$ % % %%s%t%,---D-E-F-G-[----..ںڶڢڞh2.hGhCh&*ph'h2hwpjhwpUhfh_h[h6M6]hg h[h6M h2h2hQ0}h6M h)==h6M h2h6M h6M5hM h6M5 hh6M1..6...../-/V/W/}////000$0&0(0<0>0Z0j0z00000000000(1N1X1f111̬̆̆s%h2.h2.B* mH nH phfsH tH %h2.hUOB*mH nH phsH tH %h2.hsB*mH nH phsH tH hsB*mH nH phsH tH hF}B*mH nH phsH tH hUOB*mH nH phsH tH hGB*mH nH phsH tH %h2.h2.B*mH nH phsH tH )112+252628292@2H2W2m22222 333H3P3R334 4.4D4N4m444444[555Q6\6667777 8 8889#9B9C9M9N999999S:뿳hpWkmH sH h|GmH sH h0mH sH hpWkh6M5mH sH hpWkhpWk5mH sH h ht%hshVHh$ah+%h;h_h2hB*mH nH phsH tH ^I^^^^__9_:_r____eeeeeef𰸨𰸰hwpmH sH jhwpUmH sH hBLMVe֝ߝbx&Hd|9&ݣ VXvƻwhCimH sH hghg6mH sH hgmH sH  h`S$h`S$h`S$h`S$6h`S$h`S$>*B*\phh`S$h`S$mH sH h`S$hmH sH h`S$mH sH h}n`6mH sH hwph}n`PJmH sH hwph}n`6mH sH hCsmH sH h}n`mH sH .NC0~8اnA) 0d^`0gdg 0d^`0gdHC 0d^`0gd}n`v/78Y{צߦΧ٨ϩy{TV\]gux}b:d5AGʻٻzh<3mH sH hUOmH sH h}n`6mH sH h*=hHC6mH nH sH tH hHCmH nH sH tH h*=mH nH sH tH hHCh*=mH nH sH tH hHChHCmH nH sH tH hHChHCmH sH hHCmH sH hwph}n`6mH sH h}n`mH sH -()uv#)*,45VfgԸԭxngcgcgNCh[hRXB*ph)hRX5B*CJOJQJ\^JaJphhRX h[hRXhRXB*\phh[hRXB*\phhfLmH sH jh}n`UmH sH hwph}n`6mH sH h}n`mH sH hghgmH sH hghg6mH nH sH tH hgmH nH sH tH hghgmH nH sH tH hgmH sH h<3mH sH h<3h<36mH sH )+,5x[[$d$&`#$/7$8$H$Ifa$gd|5!d$&`#$/7$8$H$Ifgd|5! d7$8$H$gdRXdgdRX hd^`gdjK 0d^`0gd}n` 0d^`0gd}n` 0d^`0gdg  %&'OSX]^cde²òƲDz̲ͲҲӲزٲ޲߲   !&',-.0GHSTXY\]bchinotuz{hfB*phh[hRXB*phhRXB*phWԱ$d$&`#$/7$8$H$Ifa$gd|5! & Fd$&`#$/7$8$H$Ifgd|5!Ff4 $ & Fd$&`#$/7$8$H$Ifa$gd|5!$d$&`#$/7$8$H$Ifa$gd|5!  &()*+,-COTFf $d$&`#$/7$8$H$Ifa$gd|5! & Fd$&`#$/7$8$H$Ifgd|5!Ff $d$&`#$/7$8$H$Ifa$gd|5!TX^dfghiju$d$&`#$/7$8$H$Ifa$gd|5! & Fd$&`#$/7$8$H$Ifgd|5!Ff$d$&`#$/7$8$H$Ifa$gd|5!òDzͲӲٲ߲ Ff$d$&`#$/7$8$H$Ifa$gd|5!$d$&`#$/7$8$H$Ifa$gd|5! & Fd$&`#$/7$8$H$Ifgd|5!Ff!'-/0HTY]ciou{Ff$$d$&`#$/7$8$H$Ifa$gd|5! & Fd$&`#$/7$8$H$Ifgd|5!Ff$d$&`#$/7$8$H$Ifa$gd|5!ӳ`abcetȹȭȢp]M]h<3B*mH nH phsH tH %h:hh:hB*mH nH phsH tH h:hhEmH nH sH tH hEB*mH nH phsH tH %h:hhEB*mH nH phsH tH hBh9B*phhGmH nH sH tH hBhBmH nH sH tH hBmH nH sH tH h9B*phh&*pB*phhRXB*phhB*phh[=hRXB*phabcefst$d$7$8$H$Ifa$gdE$d$7$8$H$Ifa$gdBd$7$8$H$Ifgd:hdgd9 d7$8$H$gdRX kd|'$$If 44ֈ !'+n <+224 af4p<yt*ĴɴδӴٴڴ =CINSY^Ff;.Ff*$d$7$8$H$Ifa$gdBd$7$8$H$Ifgd:hôĴȴ۴ #CHIM_efgixߵܼܼܬܠumemh{D3B*phhRXB*phhBhBmH nH sH tH hBhBH*mH nH sH tH hBmH nH sH tH h&*pmH nH sH tH hBB*mH nH phsH tH hGB*mH nH phsH tH h<3B*mH nH phsH tH %h:hh:hB*mH nH phsH tH h:hB*mH nH phsH tH "^_˶ d$7$8$H$IfgdO, d7$8$H$gdRX d7$8$H$gd&*pFf5$d$7$8$H$Ifa$gdBd$7$8$H$Ifgd9Ff1#$),./01PQV]^ʷ˷۷߷ ̅̅vgh*rthRXB*CJaJphh*rth*rtB*CJaJphh&B*CJaJphh/0~B*CJaJph hO,hRX>*B*CJaJphhO,h:NB*CJaJphhO,h{D3B*CJaJphh:NB*CJaJphhRXB*CJaJphh{D3B*CJaJphhO,hRXB*CJaJph( $1@Pd$7$8$H$IfgdO,PQVWX6%%%d$7$8$H$IfgdO,kd7$$Iflִf>9!5&h-T3N3 t36    44 layt&XYZ[\]d$7$8$H$IfgdO,]^p}6%%%d$7$8$H$IfgdO,kd8$$Iflִf>9!5&h-T3N3 t36    44 layt&ʷd$7$8$H$Ifgd:Nd$7$8$H$IfgdO,ʷ˷̷ӷԷ6%%%d$7$8$H$IfgdO,kd9$$Iflִf>9!5&h-T3N3 t36    44 layt&Է۷d$7$8$H$IfgdO,*=R6%%%d$7$8$H$IfgdO,kd:$$Iflִf>9!5&h-T3N3 t36    44 layt&)=QRV[\]bcghoptuvz¸ƸǸܸݸ&*+0267>?CDTUeiy}~ɽɽᢑɽɽ hO,hRX>*B*CJaJphhO,h:NB*CJaJphh&B*CJaJphh:NB*CJaJphh{D3B*CJaJphh/0~B*CJaJphhO,hRXB*CJaJphhO,h/0~B*CJaJph9RX]cvd$7$8$H$Ifgd/0~d$7$8$H$IfgdO,6%%%d$7$8$H$IfgdO,kd{;$$Iflִf>9!5&h-T3N3 t36    44 layt&ȸܸd$7$8$H$IfgdO,ܸݸ6%%%d$7$8$H$IfgdO,kdr<$$Iflִf>9!5&h-T3N3 t36    44 layt&d$7$8$H$IfgdO,kdi=$$Iflִf>9!5&h-T3N3 t036    44 layt& &+2ETd$7$8$H$Ifgd:Nd$7$8$H$IfgdO,TUkd>$$Iflִf>9!5&h-T3N3 t036    44 layt&UV]^ekyd$7$8$H$Ifgd:Nd$7$8$H$IfgdO,kd?$$Iflִf>9!5&h-T3N3 t036    44 layt&ǹ۹ܹ&*FQRhiºúĺκҺҺҺҢ{sskh&B*phh:NB*phhBhBB*phhBB*phhRXB*phh&B*CJaJphh:NB*CJaJphh{D3B*CJaJphhB*CJaJphh/0~B*CJaJphhO,hRXB*CJaJphhO,h/0~B*CJaJphhO,h:NB*CJaJph'ǹܹd$7$8$H$Ifgdd$7$8$H$IfgdO,kdA$$Iflִf>9!5&h-T3N3 t036    44 layt&%&-3AShd$7$8$H$IfgdO,hikd;B$$Iflִf>9!5&h-T3N3 t036    44 layt&./01HlrPPPPμ|v|vr|v|g|vrerUh7x0JmHnHuh h0Jjh0JUhoh<h!7.jh!7.Uh2.B*ph"hGB*mHnHphsH tH uh<3B*ph"h2.B*mHnHphsH tH u1jsCh2.h2.B*UmHnHphsH tH uhwpB*phhRXB*phh.B*ph$i/1IPPPh]hgdE &`#$gdH_y d7$8$H$gdfL 21h:pd=/ =!"#$% 51h0:pRX= /!"#$% 2$$If!v h5 55555555 5 #v #v#v#v#v#v#v#v#v #v :V ]  6`dh1,, 5 55555555 5 / 44 ]pdyt|5!kd$$If] \ Hl";&)p- 1   6`dh1((((4 ]apdyt|5!$$$If!v h5 55555555 5 #v #v#v#v#v#v#v#v#v #v :V ]  6`dh1,, 5 55555555 5 44 ]pdyt|5!kd$$If] \ Hl";&)p- 1   6`dh1((((4 ]apdyt|5!$$$If!v h5 55555555 5 #v #v#v#v#v#v#v#v#v #v :V ]  6`dh1,, 5 55555555 5 44 ]pdyt|5!kd $$If] \ Hl";&)p- 1   6`dh1((((4 ]apdyt|5!$$$If!v h5 55555555 5 #v #v#v#v#v#v#v#v#v #v :V ]  6`dh1,, 5 55555555 5 44 ]pdyt|5!kd$$If] \ Hl";&)p- 1   6`dh1((((4 ]apdyt|5!$$$If!v h5 55555555 5 #v #v#v#v#v#v#v#v#v #v :V ]  6`dh1,, 5 55555555 5 44 ]pdyt|5!kd$$If] \ Hl";&)p- 1   6`dh1((((4 ]apdyt|5!$$$If!v h5 55555555 5 #v #v#v#v#v#v#v#v#v #v :V ]  6`dh1,, 5 55555555 5 44 ]pdyt|5!kd$$If] \ Hl";&)p- 1   6`dh1((((4 ]apdyt|5!$$$If!v h5 55555555 5 #v #v#v#v#v#v#v#v#v #v :V ]  6`dh1,, 5 55555555 5 44 ]pdyt|5!kd$$If] \ Hl";&)p- 1   6`dh1((((4 ]apdyt|5!2$$If!v h5 55555555 5 #v #v#v#v#v#v#v#v#v #v :V ]  6`dh1,, 5 55555555 5 / 44 ]pdyt|5!kd"$$If] \ Hl";&)p- 1   6`dh1((((4 ]apdyt|5!$$If !vh55n5555#v#vn#v#v#v#v:V  44 <+,55n5555/ 2244 af4p<yt*$$If !vh55n55555#v#vn#v#v#v#v:V  44 F+55n55552244 af4pFyt9kd)$$If 44֞ !'+n F+224 af4pFyt9$$If !vh55n55555#v#vn#v#v#v#v:V  44 F+55n55552244 af4pFyt9kd,$$If 44֞ !'+n F+224 af4pFyt9$$If !vh55n55555#v#vn#v#v#v#v:V  44 F+55n55552244 af4pFyt9kdQ0$$If 44֞ !'+n F+224 af4pFyt9$$If !vh55n55555#v#vn#v#v#v#v:V  44 F+55n5555/ 2244 af4pFyt9kd3$$If 44֞ !'+n F+224 af4pFyt9$$If!vh555N555535#v#v#vN#v#v#v#v3#v:V l t36555N555535/ yt&$$If!vh555N555535#v#v#vN#v#v#v#v3#v:V l t36555N555535/ yt&$$If!vh555N555535#v#v#vN#v#v#v#v3#v:V l t36555N555535yt&$$If!vh555N555535#v#v#vN#v#v#v#v3#v:V l t36555N555535/ yt&$$If!vh555N555535#v#v#vN#v#v#v#v3#v:V l t36555N555535/ yt&$$If!vh555N555535#v#v#vN#v#v#v#v3#v:V l t36555N555535/ yt&6$$If!vh555N555535#v#v#vN#v#v#v#v3#v:V l t036555N555535/ / yt&($$If!vh555N555535#v#v#vN#v#v#v#v3#v:V l t036555N555535/ yt&6$$If!vh555N555535#v#v#vN#v#v#v#v3#v:V l t036555N555535/  / yt&6$$If!vh555N555535#v#v#vN#v#v#v#v3#v:V l t036555N555535/ / yt&6$$If!vh555N555535#v#v#vN#v#v#v#v3#v:V l t036555N555535/  / yt&hDd M  FmAChart 2#"D8PK!^[Content_Types].xmlj0DжXr(΢Nm)A}dB3gfb= b]g" sM g3 ~a>@FjoS Rn*>G]c#Հ%p)K/ vؗCYHQW^ W!VBa1uiUդzUo t@\v:[KMjG^Lgx8qo:M'H95ƶ xp}s;ؼ"7 Tr/PK!8! _rels/.relsj0 }qN/k؊c[F232zQLZ%R6zPT]( LJ[ۑ̱j,Z˫fLV:*f"N.]m@= 7LuP[i?T;GI4Ew=}3b9`5YCƵkρؖ9#ۄo~e?zrPK!Rdrs/downrev.xmlLOK@a4` 1"AJN?43dm^2x~Sgՙ081\dHg |?BD8:!_`]__UXZw-wSDB}uhzb I׺1&9uNxI<KQ NœoO рO]?g4%oX"TkB=aKcDjk$ C=9ɔ4^ Zڂyś(-qQ1 Oyrz\p};ۀPm,-j57V@lN9`׀ =v2\8#bğoVߞxPK!F"drs/_rels/e2oDoc.xml.rels 0nz&ЫXIFooЋqvov1ONGgYqh{كYRC׫La,Ų!F@3r{'Nynx AlXPK!/ Ndrs/charts/chart1.xmlYYo7~/]Kmq)QbԈKI S䖤l)cWGUh5pGՂTFQ0ugqJ^&8k7x] 9% @WjεntAԉh) *gZ`P6BB/ `A͗ϙ/ӦZ.(N I5oZ8F,'lR~,F)f2iFFnT˄>81kԦ |I{ՙ-9Mo8҉X]uWn: 8ɝ{ʪl2^y"Ƥp{|~ã ; v3~KPa6hC^4Gf&LHx| =\ol/VZ6A Q1oN,-w~_$ {`5=ѸvucԇoF>eJOAc`YSoV'ibO>Ol$O|t]^w5YRRg=Tm:`Td=-Rl Hl*3f& ɳ)hYy[Z(7dm/jnp8kFm5-õ '`&Pp`9 9PiCesDQc$@[:f> OeC )yRAqvX-tGmoqc2QRZ:l|؍To:3ֹ ϛqE\Ns\ ^F'eT%FqeR_Pewihh). s`I 6`$w1-@ .HBC|bfVw'V&\GQZ-!|{TIu6: \=' k"I=P>o|wJ):h;>N˓pɨlNٌJ;$:vi&ts״;RLd]bϸ>KoeCRMT[xI&^Ⱦz?˳D\Kqhm0zON&a I'e/էaH9Dn'Eb3K^^Ұ;M[98 Igw*KJ}~exYAj<°Hg`!̖z.%qTSe `GY^,vvD4@sY@LQGGi=}Póe K&).@v7r8oO3[[ݨ ͝:hGz6E켽;#eyO:mc5+M%'hHxk]ݝvrPK-!^[Content_Types].xmlPK-!8! M_rels/.relsPK-!RLdrs/downrev.xmlPK-!U*Sdrs/e2oDoc.xmlPK-!F"drs/_rels/e2oDoc.xml.relsPK-!") odrs/charts/_rels/chart1.xml.relsPK-!/ Ndrs/charts/chart1.xmlPKW bX (t03ucBXCK nX (t03ucBPNG  IHDR#A:q @;p BCGos' TU1fY; @`b#1x6'@ P*ӷ2v||{q]lK pڀ????Dg}k` @%P...J/ˏ*^KPlsd} 5m$@K2 J_AޏӍ E 0@e@A)mk6Kٯ f!Va]/ 7 @N1)Hq!W?o[00ůc_/ @XՄe-; lr15]VShzG @jos(MLr%" ,g߮[F @`JJVd`nV 0@Ekzb[ t7M8. @w1ɓ'O/^dq",^RShzo[ٳ˗kg~ @`ʀVG3wSU Aol}gnF_}U1y&{}p/_͋G"X1XA(NP~4[)Oh~JnSF6yeu|YWO?!&ͯ?nի AF !ƒW?:Qۿ+zcU'ĐM+,qVS_Yv[4-}4LhhC^TqF0 n}ѣG~a䷩8u7~]?\~Tڄ)UUXapөX[YIK69X~ComC6Z?!>iq0Ki0 R֪Uם>ZSunm x2֝balHٱoCk2&+ U1VX.q7ĿCr'kh|rO11G9ԗY{2z'#bͧ y|*t ML NVXN_5,c\Rw dkdVXƸ)$Sf sm bH`v|۞sPEMtzQ SS8ūn?)XSO^ @`6w1X@p:4;CІ'ʈVXV\ =MneacE@h3 mC`!no&_$) aG @@pUxD *qG K=$$4fv }F}C6 A> o}0;J F;U4ݢ5?M\P\akuaL8!qPBTg!=  @^i}W2 J_A۝ݽK^~n"@f~s @`AHu*% LL>E+; *BYh/e#ك 4b+(xFB:).d' s4 xc-( q O W? @i\\tXM 0@Ť6N+r03J @W1 [@ 4afW5 @@0fW5 @@}@hsǢmً @`:a:䪒Û @^@@q3⫚ @T`7 WHC@hd @C " 'm'}kہmѶ< @*P5 oݯK4KY%@ 0P( 1A 6ǜbᬽ @C1.R>:: DbK{7Vv @~v7~q@viCuiu =:=M0KL$qnjjË/ץMi;,{"|HU lLL'@iF]6mc!Jo{t3Bɥw1ʟnkaW @ ) D:L%ZU51`Pvr&{q%Ҁ vѴ?.Jyٚ&W_eul>yee}B~Suo*#?ُO݌Ҝ7ޯ )ĝb%!봚~Xc! &:asد @f\?{ʏJ۶QV$?3ȿu!kPRܫB@8s׌իذǏ>`ҀPU~TڶMmόIO&R,;Sa?xC PA @U=X+w&{ҶеGtW$>e5lL- <ϟߝ2$iE_- B`@eS5 曭8>&&+^@_X@ m>o#,35;O@_X`2W!8UM |S@`Œ=+ ̈j(]cTh WWWwL^a~&@br|`m=%Pk^v$@5 Pb'kYIKn;6F@hdWo0OJnr 鴢xXZ1-8;1_-#4;u*Q\.{ @`Nۜܔ/>eꮚ٧}cd}V R$hF0_N@7ƀ4]$w0qNQf5!  " OQRv @`z1؟AcaDnyC @`}Of^Z?# @`B<6=2(ǝ1 ؑD@柃 @PA &')5q+t[7^:˧]Sۥ %@j @`!&kxAN0$~ʲ:ٞOO0gϞ@"@`L5<㠭M96#@ꫯw1H͛7( Xׯk[I݆QNlN@H[ љM`JC# Q`#`|Z%@ϾE}Qgsxy+N NOF{ytAkU ݼlM(GoMfooh bU7cmtmCA'{ FA  5y}]ߵ+o?ϳxn!_mN JۻU,뭻45$Lȭ/ lgK ΧE0'b/O3A~_' 'Vˎ:.?'sn:Ҥڂ)CuDU~!oXgz?*;?&鴨gYhPwi@Uu.aŒ&@`6D8sݱx uQN6!$PĿ)Cu+mדOP|AM' Lgd+7]Jq#o{ С&S.b'UO):W9?O]`.Η/R`)!D_O(I#3⫚ -cTI tuT}Aiו.&&QhN)I`ʨ>:\1Z Fuð[JR"))b`ծ>}gϒOKd:?O/^N>]ϯbm^Ԯ6/ Sأ] oP P/}g qي4xQ nafW5 *˻{S7- T* lw 9(K  @`Y!ݶ)PvIqgx&AmN  P'PNNNZGO@@f/ W;h|rvv|a V@0Xmi8: 4NٸЉ$'ÇN% oT`8o;1/ۯmØe6G￿ƠD ,"@} Iybhs>K$7MŠ ]ʲ-B &1~めC9 b~: u! 죟%!`B9M]pa }GUBeOGo0k/ &}EQ&Ae\.]mK} XA1Be: ( (x.HѰմ1t{ `  . ºF؉@`|'J|@16f'XASSY!իӧ1`m 8 U`7'7ݮNf*'( C-w55K"a=]x5]O%|75L @ŒCA@_,>t}A Q#@L@q3⫚AFp h كZv @@Q@@qL3⫚D}'|}J @@c@NOO:o6{ ٛbr3W`^ڀp~~^./ 'K @*BJBٓ=~J2 ӊ}z'، ؕŒ&o?t`` @ ĭLmM a ُ.0 s{}|TM T,8@w>(gϲ7o@$@hn$f8PatUN૯=z`w @@N2 -L`+|U}'@!N- T5سR@@08/ oDؗ@)F1mo_d0 >̾H[@@q(3z1 ~L>ȿ/lL$ LۦXm+  @`:Aζd  00qe Œ^@`7k\cXY=Lͫ^Ńʺ^c~)O`P@Hל}$ 쫿m{ e].> ےT bEca{{ @YAu N1B;{nKo0x5^ @xxjrۀ+e~B?7{mGիWD ?GB$0*" 4zO>ֿC`}  @8)g6C)}!&crUX@0q;t،@c@X kƶU\\%@ 4b4~-qH@(t VVmo0O  <ʀpqqqwp\W߀Pu}&q^wDZsiO?|A׋X@mNB'O:$,! 6;l1I~ۧ=H[hD`’{G"  * e9]ix+@{ nqTζ$@K|@6~4e>E0  @ ^zS|ߴ#a}`PwQ})L 0n< K}I0g;j PyUvzz]K0a <Ȭ WX@ y }B;{;Jӧ٫WUno @`!VJBٳϳǏN?A?k{ @ TtZQ<(~L z쳷[@ v`7]@  @`ۜܔVO0nN v-9{mm7{ww7#/ @!V7+?.' s^/z[$qL @L!N# yv{{V~o G};  @`,ʀV *jX b9{1}YQ$ҳ0p%ݷɳ<<-|_WlX@c@XH;7 a @f>aF|U @ 3 aF|U @KzD{ @ 8UM `aic@@XZh @ǀ0#  @]A?8@Q@@fs @z B2ŋ -c!@lC`p{{{ lI p0v-¶ @(P<%kgM1̮e{ @ywyɓ,&MII󩎳k;} @x+ ^~N5qjvrk}OQfmK @(p6e }/V!A@6a~&@_> *ALX?(+~e?DH 'P5ُUtMBl!0lM 0@c@*B– ]uttTy]D @B@9QE_{Hl)>ퟢE@ eŋ>:ŋ 7 ]= cI* @`,nsA]XRNPV)be_ @o,;==mmC7y1'b2?E3S @`!&VB{+[ @F6 lIʇaW^ @ Hy&da}  @Kh<Ũqarԫ^ @ .J10?{ @/V@zRrӓL<~SW>uD @ w!j bI 0;u@xPW? @t tG>Q @$630#  @J0#  @B].TfO@@f/ @W鐫JoF @za" ̈j @RڻgWWW&&U, @@oۜ$6ŋwEv|W@@0* @&P!he*onnvlnh @jos+r+ŰB@n @qZ?!E899y'(Dx' s @tBjB^隷m#@Qu@ZA0ٓ @`A \\\LӪ* 줣& @`Ebtzz#u0b @FhsA_ #* @`@㓔///Wr @X@e@^Z[7as] @h}@@X`h @`Œ@@_ @!=,mZ' s @tt% D6 @8p`|uŒ&@(5ӤU]mV@h> @vĶh[ @ h|r]ggg6L$irw.Ԇ.eٖ @BGc4h2ƞ9ݔG OB4Ҵ% Km#@X;+O<zQYGtiB{ @-N@nb׋so@Ew @B`5k8±)\Ch# @r61T]p2 @ 4㈯kx SN,{ } @ '''#䛞dgSO. } @ BiY@///uD:yYX, % @*BF~U,G@SSY @c Q} a  @h Ճt8}aX M 0@e@'$Snnnު9.`vQNٓ @`ʀpuuʱW? @in>W=  @h|PZY9!pC% @+ƭNiyx @X~B?7{ @L'P4tLrwv$@F2 ĭMBAiR#$@M2 /L. YfO@@f/ @+ 4=w39B;{ @L#/^ܝntyyyߊt ')=  @h"dxǢt4M~ @&P4`9VuqqqR+ ,' @ TN+']I@ogO @i*B\?4 E 0@݊RqǢtQ+ a  @ Wļ`< @,M@@GUM P* 80UM ,m K!@0fW5 @ai== @VfŒ&@_A({Jr' s @t+m@v5o% _GGX0c 3⫚ @T53 aF|U @^~)  @d+WWWIt}dx; @V(PnnnA + @$P&;s$`bΞ @4AjF|M(U@F?:  @*]Snnn:x@Zy--%6 @-PiΫ^ @ 4]\}B;{ @L#X!8;;{k5!N?r0CJ @W1 [@ 4afW5 @@0fW5 @@}@(><aبٛ @`|a|ܦ&! @Z@@8x>aF|U @ aƁ! ̈j @aic@@XZh @@ MvrrRzqv}}Mp0Ϯ @Tׯ_?=9|qqc!«^ @ TR>y䝀pvv6]6^vx @ T8(&wuuuubu!}^ @ TsxPڰٛ @`|!^?H@!0?{ @/PR 'SߘƩH^~n"@N2 JAZ!{{{{ך8ȫ^ @ TX9({ʐtMnv֑ @*PSQQvW=  @ T$   @KQ\_p}}6o=fҁ @6#xt wa\O @ hiB!M. 7T @ EqQz&B>,^xaUa@J 0@닔cՠqGIZBv"@Xu@H!DuB % @aZ|X(>/0ZuV @,0xXZӏvB;'[ @N`Ի55 ?'@lQ` Ą Ba" % @a|ٚ&M)PSVԲU"奎"^WwZN`~,gkWe@4zZЎ,!o$^kosē l@`6 ^wE!-5˃ٙ! ^6,ʆ;>ap=߈sL*ʤ 'KW @ @ߎ @@[6Kw.F{|1C @`!ACӼ @ؾ}@[ZI`p @}@xŝLBU @Jos?쩟}bGH @`=zJK  @L. LN @WZJ @`rҀPw7&o  @8pf @X~J @M% @,Z@@Xth @ Vq/ d lWLc}6("CsHPb v&S }S}&0%cI*v#ې@>XB~\uV* 4{~ޑS15E`[¶@tC$pK +Vq_~,՟f"vfX% ! aA)F64 ]$}|4.YXh  M!F6J!@I&!د߾w+G}&w:Ds,H@@XPgh  @{@ @$ ,34 @=~ @ B @`naP? @  M!@ 00w @u @[@@O @`A‚:CS @- '@ aA) @ @X @s s  @,H@@XPgh  @{@NNNfWWW1ߎ! !mٓ'O٢)6Vj\vcq29mʏѩmO@{-7,P ?Z1;k?cs_j}m']qwc_X=s[ef661xm MJNMmR/ k9M &m`͵0@*Wڔwu]fXW,škM]o߷Mp{ 0,R) qQzfXeXk)5ձKYcp[\8t]ꋰe)Ɗ2 lU@@j:u`"$ԽbX5]P8zd|ľ─7ȇ#*~ TnofХ'ۺYݧj[@:ژ?Jux){Qz1g)gKUlWگSۧ"n]Rԋ?m vNڰ@LLlWөIe-S\%Pm-ɇrB1ܤnr׵'UV'UU_n̶ mkcoSOVS9ƺ,M3ӵܦq' D81Qckӵ?q:mC@#d?LeTM)pͪǚ\S0bW1q9tmm3 D@3tu틩~f*wh@(u/>w) 4zpaV,T-?vLbKyGXOU?c uerxwلxR-v>4Iizm@mM[1V_~xQӯ6c,_X?K]mUIUw[ǦqơM!@]ص@.?;k{7`cNO^?EqL~BLBߧ.%m?}'U?@m&mNSۚB[z/^_lca;M3ӵܱ~I֕4b6Kv FIʞܴTA-k3?!z{ؾNNQ~~壮mJꞃv]iRUWmk mݚ B3+b3u5,N3ӵܦqYlwݘkꫨ+Aql_\I*Xom9# 㨔 ''dSV'Mg}ĤXF?!M`MUF8=iUbf[}pOSO¶i^mkSbuFj2ƚҔ?3]~1dS e+:Uem͟f64 F @`$>>Ush;PkB`¶X@Ik}u35nT;V" ,#4LZ˦c<[tLSۼ^޾r]?M %IENDB`^ 02 0@P`p2( 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p 0@P`p8XV~_HmH nH sH tH @`@ NormalCJ_HaJmH sH tH DA`D Default Paragraph FontRi@R  Table Normal4 l4a (k (No List jj {x Table Grid7:V04@4 $D0Header  9r 4 @4 $DFooter  9r .!.  journalname.)@1. E Page NumberHBH G Balloon TextCJOJQJ^JaJZQZ GBalloon Text Char CJOJQJ^JaJmH sH tH BaB <0 Header CharCJaJmH sH tH PK![Content_Types].xmlj0Eжr(΢Iw},-j4 wP-t#bΙ{UTU^hd}㨫)*1P' ^W0)T9<l#$yi};~@(Hu* Dנz/0ǰ $ X3aZ,D0j~3߶b~i>3\`?/[G\!-Rk.sԻ..a濭?PK!֧6 _rels/.relsj0 }Q%v/C/}(h"O = C?hv=Ʌ%[xp{۵_Pѣ<1H0ORBdJE4b$q_6LR7`0̞O,En7Lib/SeеPK!kytheme/theme/themeManager.xml M @}w7c(EbˮCAǠҟ7՛K Y, e.|,H,lxɴIsQ}#Ր ֵ+!,^$j=GW)E+& 8PK!Ptheme/theme/theme1.xmlYOo6w toc'vuر-MniP@I}úama[إ4:lЯGRX^6؊>$ !)O^rC$y@/yH*񄴽)޵߻UDb`}"qۋJחX^)I`nEp)liV[]1M<OP6r=zgbIguSebORD۫qu gZo~ٺlAplxpT0+[}`jzAV2Fi@qv֬5\|ʜ̭NleXdsjcs7f W+Ն7`g ȘJj|h(KD- dXiJ؇(x$( :;˹! I_TS 1?E??ZBΪmU/?~xY'y5g&΋/ɋ>GMGeD3Vq%'#q$8K)fw9:ĵ x}rxwr:\TZaG*y8IjbRc|XŻǿI u3KGnD1NIBs RuK>V.EL+M2#'fi ~V vl{u8zH *:(W☕ ~JTe\O*tHGHY}KNP*ݾ˦TѼ9/#A7qZ$*c?qUnwN%Oi4 =3ڗP 1Pm \\9Mؓ2aD];Yt\[x]}Wr|]g- eW )6-rCSj id DЇAΜIqbJ#x꺃 6k#ASh&ʌt(Q%p%m&]caSl=X\P1Mh9MVdDAaVB[݈fJíP|8 քAV^f Hn- "d>znNJ ة>b&2vKyϼD:,AGm\nziÙ.uχYC6OMf3or$5NHT[XF64T,ќM0E)`#5XY`פ;%1U٥m;R>QD DcpU'&LE/pm%]8firS4d 7y\`JnίI R3U~7+׸#m qBiDi*L69mY&iHE=(K&N!V.KeLDĕ{D vEꦚdeNƟe(MN9ߜR6&3(a/DUz<{ˊYȳV)9Z[4^n5!J?Q3eBoCM m<.vpIYfZY_p[=al-Y}Nc͙ŋ4vfavl'SA8|*u{-ߟ0%M07%<ҍPK! ѐ'theme/theme/_rels/themeManager.xml.relsM 0wooӺ&݈Э5 6?$Q ,.aic21h:qm@RN;d`o7gK(M&$R(.1r'JЊT8V"AȻHu}|$b{P8g/]QAsم(#L[PK-![Content_Types].xmlPK-!֧6 +_rels/.relsPK-!kytheme/theme/themeManager.xmlPK-!Ptheme/theme/theme1.xmlPK-! ѐ' theme/theme/_rels/themeManager.xml.relsPK] էR4R 4?LLLLLLLLLO MLXYe[tQ5g.1S:K\f6y} jvP  !&]z)T^ PX]ʷԷRܸTUhiP    "#$%'f ^ '''K5w56=>&>QEaEEKKLPPRT UU\\]bb[cjjbltt?uB[ϏM`ԬK<P*ؾ(=7M   s,%D%2R8m8,;@@FPPjV|\\\ddrfnn@x~~_g~ҧQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQTQT4;?FHO!!8@0(  B S  ?igjtgk4glfmfntfo4fpeqertes4etdudvtdw4dxcycztc{4c|b}b~tb4baata4a2=EEMWnx 5>     1<DKU^^t3<FF   =*urn:schemas-microsoft-com:office:smarttags PlaceType=*urn:schemas-microsoft-com:office:smarttags PlaceName9*urn:schemas-microsoft-com:office:smarttagsplaceB*urn:schemas-microsoft-com:office:smarttagscountry-region8*urn:schemas-microsoft-com:office:smarttagsCity>*urn:schemas-microsoft-com:office:smarttags PostalCode = m}6Q''M5S5c5i5==SEZEKKKKPP#$1??@PƝŞ͞Ӟaiʟϟgmu~@FLU[cinv|$.Xagmuz`go{'emvצߦAKFP¨(0]^^``aacdfgi_n-}Zd2BNS% * q*w*G/J/?@Ŏw9ǐEFɑݒZ}~)xf(Q /x?ٙ019'MN|@CߞxU `(|ާ9a *^^``aacdfgij33333333333333333333333333333333333333333333333333333333333#)m}6QQQQQQQQQQ 8n7!=C'-%%&&6&6&7&7&&&''''''(( ( (((I/I///11p8p8:::U: AABEPQSvTddp4pRp_prptpqUqsssvvv4fLs [=ckBpe{xk@r /,=[a33s O E)!|5!pp!ot!QF"u#`S$t%4&2((9)~)**t,O, -X-2.!7./a/-0-v192]2`23C3{D35Y3E4 55Z5x6b78U69&:s;|;7<*=d=>P >s> @%@AuBOB\FBC.9CHC1|CD\EnELGWlG|G^FHo2I}I8KjKxL)L\:LKL#WMkMOAOUORP]P Q.RTS=SGVT#V{9WRXwXG Y[w\y\o_]^.&^_=`F`}n`IbF%cmd>ѻ]>aٱi5=A°Sl2Cڗ)4<7o? N}B7x[Wq|'}5#H.FOUDH]xzas.T*9$aZCVH^>bO,JHfi>7U5+Y #jgr kTn*Zdo?AE:N!;f&:wp +m | PX:hyVH='~T-`5MsS^)Qin8I }*a*'nv>B#'6MC1 !ew99%^)n.Oec/ D' +%[&26_zj*I$Q2rT{V;-C$DoSoGRT'vd-WI_:[I=!=_:#g"y R0_(t l^`REFMGR.InstantFormat` REFMGR.LayoutREFMGR.Librariesg s<InstantFormat><Enabled>0</Enabled><ScanUnformatted>1</ScanUnformatted><ScanChanges>1</ScanChanges></InstantFormat>S<Layout><StartingRefnum>American Psychological Association 5th ed</StartingRefnum><FontName>Times New Roman</FontName><FontSize>12</FontSize><ReflistTitle>Reference List</ReflistTitle><SpaceAfter>1</SpaceAfter><ReflistOrder>1</ReflistOrder><CitationOrder>0</CitationOrder><NumberReferences>0</NumberReferences><FirstLineIndent>0</FirstLineIndent><HangingIndent>720</HangingIndent><LineSpacing>2</LineSpacing><ShowReprint>1</ShowReprint><ShowNotes>0</ShowNotes><ShowKeywords>0</ShowKeywords><ShortFormFields>0</ShortFormFields><ShowRecordID>0</ShowRecordID><ShowAbstract>0</ShowAbstract></Layout>U<Databases><Libraries><item>salsa social support paper</item></Libraries></Databases>@??0@??4'(@0d@@UnknownG* Times New Roman5Symbol3. * ArialK. ??@Arial Unicode MS5. *aTahomaA BCambria Math"1h@q@q4d2qHX ? 2!xxSocial support and the maintenance of recommended levels of regular physical activity: What are the social cognitive mechanismsTestgjm4  Oh+'0(4DP\p     Social support and the maintenance of recommended levels of regular physical activity: What are the social cognitive mechanismsTest Normal.dotmgjm44Microsoft Office Word@ @ms@b@Pc@q՜.+,0 hp  h$Epidemiology & Public Health, UCL Social support and the maintenance of recommended levels of regular physical activity: What are the social cognitive mechanisms Title  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~      !"#$%&'()+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~Root Entry FFqcData *]1Table&KWordDocumentkRSummaryInformation(DocumentSummaryInformation8CompObjy  F'Microsoft Office Word 97-2003 Document MSWordDocWord.Document.89q